Citrus Sinensis ID: 024159

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-

MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGFGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP

cHHHHHHHHccccccccEEEEEEccEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccccccccccHHccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHcccHHHHHHHHHHccccccccccccccEEEEEcccccccccccHHHHHHccccccccHHHHHHHHHHHHHHccccc

cHHHHHHHHHcccccccEEEEEcccEEEccccHHcccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEcccEEEEcccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccHHHHHHHHHHHHccHHHHcccEEccccccEcHHHHHHHHHHHccccccccccccccccccHHHHHHccHHHHHHHHHHcccccccHHHHHcccHHcccccccHHHHccHHHHHHcccccccccHHHHHHHHHHHHHccccc

MFRNVLRSiipnapnlRHICLqtggkhylgpfdcigkipydppftedlprlniplfyynqeDILFEEVEkregltwsihrpfgifgfspySLMNIIATLCMYAAICkhegipllfpgtketwegfseysdaDLIAEQQIWAAVDANArneafnctngdvfKWKHLWKALAEQFEienygfgdekdseRMRLgefmkgkesVWEEIVREnqlqptklneVAVWSYADMGLNIGAGYLVSmnkskehgflgfrnsknSFVTWIGRlkshrivp

MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEienygfgdekdsERMRLGEFMKGKESVWEEIVrenqlqptklNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFlgfrnsknsfvtwigrlkshrivp

****VLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGFG************FMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFLGFRNSKNSFVTWIGRLK******

MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGFG*******MRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		271	2.2.26 [Sep-21-2011]
Q9STX2		388	3-oxo-Delta(4,5)-steroid	yes	no	0.985	0.688	0.690	1e-106
Q6PQJ9		389	3-oxo-Delta(4,5)-steroid	N/A	no	0.985	0.686	0.639	1e-100
O74913		405	Uncharacterized protein C	yes	no	0.981	0.656	0.268	3e-21

>sp\|Q9STX2\|VEP1_ARATH 3-oxo-Delta(4,5)-steroid 5-beta-reductase OS=Arabidopsis thaliana GN=VEP1 PE=1 SV=1	Back alignment and function desciption

 Score =  385 bits (990), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/271 (69%), Positives = 217/271 (80%), Gaps = 4/271 (1%)

Query: 1   MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQ 60
           M RNVL++IIP APNLRH+CLQTG KHYLGPF  +    +DPPFTED+PRL I  FYY Q
Sbjct: 122 MLRNVLQAIIPYAPNLRHVCLQTGTKHYLGPFTNVDGPRHDPPFTEDMPRLQIQNFYYTQ 181

Query: 61  EDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKE 120
           EDILFEE++K E +TWSIHRP  IFGFSPYSLMNI+ TLC+YAAICKHEG PLLFPG+K+
Sbjct: 182 EDILFEEIKKIETVTWSIHRPNMIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKK 241

Query: 121 TWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGF 180
            WEGF   SDADLIAEQQIWAAVD  A+NEAFNC N D+FKWKHLWK LAEQF IE YGF
Sbjct: 242 AWEGFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGF 301

Query: 181 GDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMN 240
            + K+   + L E MKGKE VWEE+V+ENQLQ  KL EV VW +AD+ L +  G + SMN
Sbjct: 302 EEGKN---LGLVEMMKGKERVWEEMVKENQLQEKKLEEVGVWWFADVILGV-EGMIDSMN 357

Query: 241 KSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP 271
           KSKE+GFLGFRNS NSF++WI + K+ +IVP
Sbjct: 358 KSKEYGFLGFRNSNNSFISWIDKYKAFKIVP 388

Involved in vascular strand development. Catalyzes the stereospecific conversion of progesterone to 5-beta-pregnane-3,20-dione. Can use progesterone, testosterone, 21-acetyl cortexone, 2-cyclohexenone, but-1-en-3-one, ethyl acrylate, ethylmethacrylate, cortisone and canarigenone as substrates, lower activity with 3-methyl-2-cyclohexenone and 3,5,5-trimethyl-2-cyclohexenone as substrate, and no activity with canarigenin, canarigenin digitoxoside and pregnenolone. May be involved in the formation of 5-beta phytoecdysteroids.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 3

>sp\|Q6PQJ9\|5BPOR_DIGLA 3-oxo-Delta(4,5)-steroid 5-beta-reductase OS=Digitalis lanata PE=1 SV=1	Back alignment and function description

>sp\|O74913\|YJ72_SCHPO Uncharacterized protein C757.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.02c PE=4 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		271
255538116		390	conserved hypothetical protein [Ricinus	0.988	0.687	0.720	1e-112
295881582		389	progesterone 5-beta-reductase [Erysimum	0.985	0.686	0.691	1e-107
374085803		389	putative progesterone 5-beta-reductase [	0.985	0.686	0.683	1e-107
428676533		388	putative progesterone 5-beta-reductase [	0.985	0.688	0.686	1e-106
297803694		388	hypothetical protein ARALYDRAFT_914168 [	0.985	0.688	0.682	1e-106
428676535		388	putative progesterone 5-beta-reductase [	0.985	0.688	0.682	1e-106
374257403		389	progesterone 5-beta-reductase [Erysimum	0.985	0.686	0.691	1e-106
346540264		390	progesterone 5beta-reductase [Erysimum s	0.985	0.684	0.688	1e-106
358348859		390	Progesterone 5-beta-reductase [Medicago	0.988	0.687	0.669	1e-106
356514451		388	PREDICTED: uncharacterized protein C757.	0.981	0.685	0.687	1e-106

>gi\|255538116\|ref\|XP_002510123.1\| conserved hypothetical protein [Ricinus communis] gi\|223550824\|gb\|EEF52310.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/272 (72%), Positives = 226/272 (83%), Gaps = 4/272 (1%)

Query: 1   MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKI-PYDPPFTEDLPRLNIPLFYYN 59
           MFRNVL+++IPNAPNLRHICLQTG KHY+GPF+ +GKI  +DPPFTEDLPRL+ P FYY 
Sbjct: 122 MFRNVLQAVIPNAPNLRHICLQTGAKHYVGPFESLGKIQTHDPPFTEDLPRLDAPNFYYT 181

Query: 60  QEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTK 119
            EDI+FEEV K+EGLTWSIHRP  IFGFSPYSLMNII TLC+YA ICKHEG+PLLFPGTK
Sbjct: 182 LEDIMFEEVAKKEGLTWSIHRPDQIFGFSPYSLMNIIGTLCVYATICKHEGLPLLFPGTK 241

Query: 120 ETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYG 179
             W  +S  SDADLIAE QIWA+VD  A++EAFNC NGDVFKWKH WK LAEQF IE YG
Sbjct: 242 AAWNCYSVASDADLIAEHQIWASVDPYAKDEAFNCNNGDVFKWKHFWKVLAEQFGIEEYG 301

Query: 180 FGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSM 239
           F  E+  +R+ L E MKGKE+VWEEIV ENQLQPTKL+EVAVW + D+ L  G   + SM
Sbjct: 302 F--EEGEKRLSLVEMMKGKEAVWEEIVSENQLQPTKLDEVAVWWFVDLMLG-GEAVISSM 358

Query: 240 NKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP 271
           NKSKEHGFLGFRNSKNSF +WI ++K+++IVP
Sbjct: 359 NKSKEHGFLGFRNSKNSFASWIDKMKAYKIVP 390

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|295881582\|gb\|ADG56545.1\| progesterone 5-beta-reductase [Erysimum rhaeticum]	Back alignment and taxonomy information

>gi\|374085803\|gb\|AEY82380.1\| putative progesterone 5-beta-reductase [Lunaria annua]	Back alignment and taxonomy information

>gi\|428676533\|gb\|AFZ42258.1\| putative progesterone 5-beta-reductase [Nasturtium officinale]	Back alignment and taxonomy information

>gi\|297803694\|ref\|XP_002869731.1\| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. lyrata] gi\|297315567\|gb\|EFH45990.1\| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|428676535\|gb\|AFZ42259.1\| putative progesterone 5-beta-reductase [Aethionema grandiflorum]	Back alignment and taxonomy information

>gi\|374257403\|gb\|AEZ01593.1\| progesterone 5-beta-reductase [Erysimum odoratum]	Back alignment and taxonomy information

>gi\|346540264\|gb\|AEO36946.1\| progesterone 5beta-reductase [Erysimum scoparium]	Back alignment and taxonomy information

>gi\|358348859\|ref\|XP_003638459.1\| Progesterone 5-beta-reductase [Medicago truncatula] gi\|355504394\|gb\|AES85597.1\| Progesterone 5-beta-reductase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356514451\|ref\|XP_003525919.1\| PREDICTED: uncharacterized protein C757.02c-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		271
TAIR\|locus:2135932		388	VEP1 "VEIN PATTERNING 1" [Arab	0.985	0.688	0.690	1e-100
UNIPROTKB\|Q48IK0		353	PSPPH_2587 "Aldo-keto reductas	0.966	0.742	0.407	8.3e-51
UNIPROTKB\|Q882D3		353	PSPTO_2695 "Uncharacterized pr	0.966	0.742	0.396	5.2e-49
UNIPROTKB\|Q4K649		386	PFL_5207 "Uncharacterized prot	0.955	0.670	0.354	2.2e-41
TAIR\|locus:2178793		386	AT5G58750 [Arabidopsis thalian	0.988	0.694	0.323	1.5e-35
ASPGD\|ASPL0000051603		376	AN9028 [Emericella nidulans (t	0.977	0.704	0.314	1.6e-29
POMBASE\|SPCC757.02c		405	SPCC757.02c "epimarase (predic	0.630	0.422	0.342	2.9e-20
ASPGD\|ASPL0000040978		437	AN2921 [Emericella nidulans (t	0.616	0.382	0.350	3.5e-18
ASPGD\|ASPL0000017248		424	AN4177 [Emericella nidulans (t	0.442	0.283	0.352	5.8e-16

TAIR\|locus:2135932 VEP1 "VEIN PATTERNING 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 999 (356.7 bits), Expect = 1.0e-100, P = 1.0e-100
 Identities = 187/271 (69%), Positives = 217/271 (80%)

Query:     1 MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQ 60
             M RNVL++IIP APNLRH+CLQTG KHYLGPF  +    +DPPFTED+PRL I  FYY Q
Sbjct:   122 MLRNVLQAIIPYAPNLRHVCLQTGTKHYLGPFTNVDGPRHDPPFTEDMPRLQIQNFYYTQ 181

Query:    61 EDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKE 120
             EDILFEE++K E +TWSIHRP  IFGFSPYSLMNI+ TLC+YAAICKHEG PLLFPG+K+
Sbjct:   182 EDILFEEIKKIETVTWSIHRPNMIFGFSPYSLMNIVGTLCVYAAICKHEGSPLLFPGSKK 241

Query:   121 TWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGF 180
              WEGF   SDADLIAEQQIWAAVD  A+NEAFNC N D+FKWKHLWK LAEQF IE YGF
Sbjct:   242 AWEGFMTASDADLIAEQQIWAAVDPYAKNEAFNCNNADIFKWKHLWKILAEQFGIEEYGF 301

Query:   181 GDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMN 240
              + K+   + L E MKGKE VWEE+V+ENQLQ  KL EV VW +AD+ L +  G + SMN
Sbjct:   302 EEGKN---LGLVEMMKGKERVWEEMVKENQLQEKKLEEVGVWWFADVILGV-EGMIDSMN 357

Query:   241 KSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP 271
             KSKE+GFLGFRNS NSF++WI + K+ +IVP
Sbjct:   358 KSKEYGFLGFRNSNNSFISWIDKYKAFKIVP 388

GO:0000166 "nucleotide binding" evidence=IEA

GO:0009611 "response to wounding" evidence=IEP

GO:0010051 "xylem and phloem pattern formation" evidence=IMP

GO:0008202 "steroid metabolic process" evidence=IDA

GO:0035671 "enone reductase activity" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

UNIPROTKB\|Q48IK0 PSPPH_2587 "Aldo-keto reductase family protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)]	Back alignment and assigned GO terms

UNIPROTKB\|Q882D3 PSPTO_2695 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4K649 PFL_5207 "Uncharacterized protein" [Pseudomonas protegens Pf-5 (taxid:220664)]	Back alignment and assigned GO terms

TAIR\|locus:2178793 AT5G58750 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000051603 AN9028 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

POMBASE\|SPCC757.02c SPCC757.02c "epimarase (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000040978 AN2921 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000017248 AN4177 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9STX2	VEP1_ARATH	1, ., 3, ., 1, ., 3	0.6900	0.9852	0.6881	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	scaffold_701910.1	annotation not avaliable (388 aa)
		(Arabidopsis lyrata)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		271
cd08948		308	cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta	7e-91

>gnl\|CDD\|187652 cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta-reductase-like proteins (5beta-POR), atypical (a) SDRs	Back alignment and domain information

 Score =  271 bits (694), Expect = 7e-91
 Identities = 93/214 (43%), Positives = 121/214 (56%), Gaps = 6/214 (2%)

Query: 1   MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQ 60
           M RN L ++ P +PNL+H+ LQTG KHY            + P  ED PRL  P FYY+Q
Sbjct: 95  MLRNFLDALEPASPNLKHVVLQTGTKHYGVHLGPFKTPRPEEPAREDPPRLLPPNFYYDQ 154

Query: 61  EDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKE 120
           ED+LFE  + +   TWS+ RP  I GF+P + MN+  TL +YAAIC+  G PL FPG+  
Sbjct: 155 EDLLFEAAKGKGW-TWSVLRPDAIIGFAPGNAMNLALTLAVYAAICRELGAPLRFPGSPA 213

Query: 121 TWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGF 180
            W   S+ +DA L+A   IWAA    A NEAFN TNGDVF+WK LW  LAE F +E    
Sbjct: 214 AWNALSDATDARLLARFTIWAATHPEAANEAFNVTNGDVFRWKELWPRLAEYFGLEGAPP 273

Query: 181 GDEKDSE---RMRLGEFMKGKE--SVWEEIVREN 209
             E ++         E M      + W+E+V  +
Sbjct: 274 EPEAEAGADKAPVWEELMADHGLQAAWDELVERH 307

5beta-POR catalyzes the reduction of progesterone to 5beta-pregnane-3,20-dione in Digitalis plants. This subgroup of atypical-extended SDRs, shares the structure of an extended SDR, but has a different glycine-rich nucleotide binding motif (GXXGXXG) and lacks the YXXXK active site motif of classical and extended SDRs. Tyr-179 and Lys 147 are present in the active site, but not in the usual SDR configuration. Given these differences, it has been proposed that this subfamily represents a new SDR class. Other atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 308

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		271
COG1088		340	RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope	99.98
KOG0747		331	consensus Putative NAD+-dependent epimerases [Carb	99.96
PRK15181		348	Vi polysaccharide biosynthesis protein TviC; Provi	99.96
COG1087		329	GalE UDP-glucose 4-epimerase [Cell envelope biogen	99.95
PRK10217		355	dTDP-glucose 4,6-dehydratase; Provisional	99.93
PLN02166		436	dTDP-glucose 4,6-dehydratase	99.93
PLN02572		442	UDP-sulfoquinovose synthase	99.93
PLN02427		386	UDP-apiose/xylose synthase	99.92
PLN00016		378	RNA-binding protein; Provisional	99.92
PLN02725		306	GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas	99.92
PLN02206		442	UDP-glucuronate decarboxylase	99.92
PRK11150		308	rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro	99.92
PLN02260		668	probable rhamnose biosynthetic enzyme	99.92
PLN02214		342	cinnamoyl-CoA reductase	99.92
KOG1429		350	consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro	99.92
PRK08125		660	bifunctional UDP-glucuronic acid decarboxylase/UDP	99.91
PRK10084		352	dTDP-glucose 4,6 dehydratase; Provisional	99.91
PLN02653		340	GDP-mannose 4,6-dehydratase	99.91
TIGR01472		343	gmd GDP-mannose 4,6-dehydratase. Excluded from thi	99.91
PRK11908		347	NAD-dependent epimerase/dehydratase family protein	99.91
PLN02695		370	GDP-D-mannose-3',5'-epimerase	99.91
PLN02240		352	UDP-glucose 4-epimerase	99.91
PRK10675		338	UDP-galactose-4-epimerase; Provisional	99.9
PLN02989		325	cinnamyl-alcohol dehydrogenase family protein	99.9
TIGR02622		349	CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member	99.9
PLN00198		338	anthocyanidin reductase; Provisional	99.89
TIGR03466		328	HpnA hopanoid-associated sugar epimerase. The sequ	99.89
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	99.89
PRK09987		299	dTDP-4-dehydrorhamnose reductase; Provisional	99.89
KOG1430		361	consensus C-3 sterol dehydrogenase/3-beta-hydroxys	99.88
TIGR01181		317	dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This	99.88
PLN02650		351	dihydroflavonol-4-reductase	99.88
PLN02986		322	cinnamyl-alcohol dehydrogenase family protein	99.88
PLN02896		353	cinnamyl-alcohol dehydrogenase	99.88
COG0451		314	WcaG Nucleoside-diphosphate-sugar epimerases [Cell	99.87
TIGR02197		314	heptose_epim ADP-L-glycero-D-manno-heptose-6-epime	99.87
TIGR01214		287	rmlD dTDP-4-dehydrorhamnose reductase. This enzyme	99.87
TIGR01179		328	galE UDP-glucose-4-epimerase. This enzyme intercon	99.86
PF01073		280	3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso	99.83
TIGR01777		292	yfcH conserved hypothetical protein TIGR01777. Thi	99.81
KOG1371		343	consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo	99.8
PRK07201		657	short chain dehydrogenase; Provisional	99.77
PF01370		236	Epimerase: NAD dependent epimerase/dehydratase fam	99.75
PLN02686		367	cinnamoyl-CoA reductase	99.73
KOG1431		315	consensus GDP-L-fucose synthetase [Carbohydrate tr	99.73
PRK05865		854	hypothetical protein; Provisional	99.72
PF04321		286	RmlD_sub_bind: RmlD substrate binding domain; Inte	99.68
PLN02996		491	fatty acyl-CoA reductase	99.66
CHL00194		317	ycf39 Ycf39; Provisional	99.64
COG1091		281	RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo	99.6
KOG1502		327	consensus Flavonol reductase/cinnamoyl-CoA reducta	99.6
TIGR01746		367	Thioester-redct thioester reductase domain. It has	99.59
TIGR03589		324	PseB UDP-N-acetylglucosamine 4,6-dehydratase. This	99.58
COG1090		297	Predicted nucleoside-diphosphate sugar epimerase [	99.56
COG1089		345	Gmd GDP-D-mannose dehydratase [Cell envelope bioge	99.48
PLN02583		297	cinnamoyl-CoA reductase	99.46
PLN02778		298	3,5-epimerase/4-reductase	99.45
PLN02657		390	3,8-divinyl protochlorophyllide a 8-vinyl reductas	99.39
TIGR03443		1389	alpha_am_amid L-aminoadipate-semialdehyde dehydrog	99.3
PLN02503		605	fatty acyl-CoA reductase 2	99.28
PLN02260		668	probable rhamnose biosynthetic enzyme	99.23
PRK12320		699	hypothetical protein; Provisional	99.21
TIGR03649		285	ergot_EASG ergot alkaloid biosynthesis protein, AF	99.2
KOG3019		315	consensus Predicted nucleoside-diphosphate sugar e	99.0
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	98.65
KOG1372		376	consensus GDP-mannose 4,6 dehydratase [Carbohydrat	98.64
PF02719		293	Polysacc_synt_2: Polysaccharide biosynthesis prote	98.57
COG1086		588	Predicted nucleoside-diphosphate sugar epimerases	98.41
KOG2865		391	consensus NADH:ubiquinone oxidoreductase, NDUFA9/3	98.41
PF07993		249	NAD_binding_4: Male sterility protein; InterPro: I	98.37
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	98.33
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	98.17
COG3320		382	Putative dehydrogenase domain of multifunctional n	97.94
PF13950		62	Epimerase_Csub: UDP-glucose 4-epimerase C-term sub	97.91
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	97.78
TIGR01963		255	PHB_DH 3-hydroxybutyrate dehydrogenase. This model	97.77
PRK06482		276	short chain dehydrogenase; Provisional	97.65
KOG1221		467	consensus Acyl-CoA reductase [Lipid transport and	97.59
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	97.59
PRK12825		249	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	97.53
PLN03209		576	translocon at the inner envelope of chloroplast su	97.52
PRK08263		275	short chain dehydrogenase; Provisional	97.37
PRK07074		257	short chain dehydrogenase; Provisional	97.36
PRK09135		249	pteridine reductase; Provisional	97.3
COG0702		275	Predicted nucleoside-diphosphate-sugar epimerases	97.1
PRK05875		276	short chain dehydrogenase; Provisional	97.08
PRK12829		264	short chain dehydrogenase; Provisional	97.04
PRK07806		248	short chain dehydrogenase; Provisional	96.99
KOG4288		283	consensus Predicted oxidoreductase [General functi	96.96
PRK07775		274	short chain dehydrogenase; Provisional	96.94
PRK12746		254	short chain dehydrogenase; Provisional	96.92
PRK06077		252	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.87
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	96.85
PRK06914		280	short chain dehydrogenase; Provisional	96.66
KOG2774		366	consensus NAD dependent epimerase [General functio	96.58
PRK12823		260	benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat	96.57
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.54
PRK12828		239	short chain dehydrogenase; Provisional	96.48
PRK09186		256	flagellin modification protein A; Provisional	96.19
PRK07067		257	sorbitol dehydrogenase; Provisional	96.17
PRK08324		681	short chain dehydrogenase; Validated	96.15
PRK07060		245	short chain dehydrogenase; Provisional	96.14
PRK12745		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	96.1
PRK08219		227	short chain dehydrogenase; Provisional	95.96
PRK07774		250	short chain dehydrogenase; Provisional	95.93
TIGR03206		250	benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr	95.88
PRK12384		259	sorbitol-6-phosphate dehydrogenase; Provisional	95.85
PRK06138		252	short chain dehydrogenase; Provisional	95.74
PRK08217		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.68
PRK12935		247	acetoacetyl-CoA reductase; Provisional	95.68
TIGR01830		239	3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re	95.67
PRK08063		250	enoyl-(acyl carrier protein) reductase; Provisiona	95.36
PRK06128		300	oxidoreductase; Provisional	95.31
PRK07523		255	gluconate 5-dehydrogenase; Provisional	94.99
PRK09730		247	putative NAD(P)-binding oxidoreductase; Provisiona	94.94
PRK06701		290	short chain dehydrogenase; Provisional	94.81
PRK12827		249	short chain dehydrogenase; Provisional	94.73
PRK07890		258	short chain dehydrogenase; Provisional	94.68
PRK07577		234	short chain dehydrogenase; Provisional	94.37
PRK05876		275	short chain dehydrogenase; Provisional	94.35
PRK05557		248	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.22
PRK06196		315	oxidoreductase; Provisional	93.93
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.9
KOG1203		411	consensus Predicted dehydrogenase [Carbohydrate tr	93.86
PRK06523		260	short chain dehydrogenase; Provisional	93.81
PRK06123		248	short chain dehydrogenase; Provisional	93.67
PRK06180		277	short chain dehydrogenase; Provisional	93.39
PRK08220		252	2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	93.22
PRK07453		322	protochlorophyllide oxidoreductase; Validated	93.17
PRK07069		251	short chain dehydrogenase; Validated	92.94
PRK12824		245	acetoacetyl-CoA reductase; Provisional	92.26
PRK06194		287	hypothetical protein; Provisional	91.59
PRK08213		259	gluconate 5-dehydrogenase; Provisional	91.3
PRK06181		263	short chain dehydrogenase; Provisional	91.11
PRK08017		256	oxidoreductase; Provisional	90.97
PRK08628		258	short chain dehydrogenase; Provisional	90.68
PRK06500		249	short chain dehydrogenase; Provisional	90.59
PRK09134		258	short chain dehydrogenase; Provisional	90.49
PRK12939		250	short chain dehydrogenase; Provisional	89.51
PRK06179		270	short chain dehydrogenase; Provisional	88.95
PRK07985		294	oxidoreductase; Provisional	88.73
PRK12936		245	3-ketoacyl-(acyl-carrier-protein) reductase NodG;	88.27
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	88.18
PRK12748		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	88.03
PRK07041		230	short chain dehydrogenase; Provisional	87.32
PRK06197		306	short chain dehydrogenase; Provisional	87.09
PRK05650		270	short chain dehydrogenase; Provisional	86.21
COG2910		211	Putative NADH-flavin reductase [General function p	85.84
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	85.73
PRK06550		235	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	85.67
PRK10538		248	malonic semialdehyde reductase; Provisional	85.49
PRK12938		246	acetyacetyl-CoA reductase; Provisional	85.28
PRK12937		245	short chain dehydrogenase; Provisional	84.94
PRK06198		260	short chain dehydrogenase; Provisional	84.79
PRK06124		256	gluconate 5-dehydrogenase; Provisional	84.78
TIGR01829		242	AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy	84.65
PRK06841		255	short chain dehydrogenase; Provisional	84.33
TIGR02415		254	23BDH acetoin reductases. One member of this famil	84.17
PRK12747		252	short chain dehydrogenase; Provisional	83.16
PRK06463		255	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	82.79
PLN02253		280	xanthoxin dehydrogenase	82.56
PRK07109		334	short chain dehydrogenase; Provisional	82.52
PRK12744		257	short chain dehydrogenase; Provisional	82.12
PRK06057		255	short chain dehydrogenase; Provisional	81.73
PRK07666		239	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	81.38
PRK09242		257	tropinone reductase; Provisional	81.27
PRK08277		278	D-mannonate oxidoreductase; Provisional	80.2

>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

Probab=99.98  E-value=1.5e-31  Score=230.09  Aligned_cols=211  Identities=16%  Similarity=0.149  Sum_probs=163.7

Q ss_pred             HHHHHHHhccCCCCceEEEEEeCCceeccccccCCCCCCCCCCCCCCCCCCCCCCcHHH----HH-HHHHHHhhcCCceE
Q 024159            2 FRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQ----ED-ILFEEVEKREGLTW   76 (271)
Q Consensus         2 ~~nll~a~~~~~~~l~r~v~~Ss~~vYG~~~~~~g~~~~~~P~~E~~p~~p~p~~~y~~----e~-~l~~~~~~~~~~~~   76 (271)
                      |.|||||+++.... -||+++|+..|||+.  ..    ..-.++|++|..|.  |+|++    .| +++.+. +.+|+|+
T Consensus       105 T~~LLEaar~~~~~-frf~HISTDEVYG~l--~~----~~~~FtE~tp~~Ps--SPYSASKAasD~lVray~-~TYglp~  174 (340)
T COG1088         105 TYTLLEAARKYWGK-FRFHHISTDEVYGDL--GL----DDDAFTETTPYNPS--SPYSASKAASDLLVRAYV-RTYGLPA  174 (340)
T ss_pred             HHHHHHHHHHhccc-ceEEEeccccccccc--cC----CCCCcccCCCCCCC--CCcchhhhhHHHHHHHHH-HHcCCce
Confidence            57999999996322 599999999999975  11    11258999999876  45544    33 344665 8999999


Q ss_pred             EEecCCceeccCCCchhhHHHHHHHHHHHHHHhCCCeeeCCCccccccccccccHHHHHHHHHHHhcCCCCCCceeeccC
Q 024159           77 SIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTN  156 (271)
Q Consensus        77 ~ilRP~~VyG~~~~~~~~~~~~~~i~~~~~r~~g~pl~~~G~~~~~~~~~~~~~v~~la~a~i~a~~~~~~~ge~fNi~d  156 (271)
                      +|.|++|.|||.+  +...++|..|..++   .|.|+|++|+|.   |+||++||+|.++|+-..++.. ..||+|||+.
T Consensus       175 ~ItrcSNNYGPyq--fpEKlIP~~I~nal---~g~~lpvYGdG~---~iRDWl~VeDh~~ai~~Vl~kg-~~GE~YNIgg  245 (340)
T COG1088         175 TITRCSNNYGPYQ--FPEKLIPLMIINAL---LGKPLPVYGDGL---QIRDWLYVEDHCRAIDLVLTKG-KIGETYNIGG  245 (340)
T ss_pred             EEecCCCCcCCCc--CchhhhHHHHHHHH---cCCCCceecCCc---ceeeeEEeHhHHHHHHHHHhcC-cCCceEEeCC
Confidence            9999999999987  44566777776666   499999999998   9999999999999955555554 4599999999


Q ss_pred             CCcccHHHHHHHHHHHhccccCCCCCCcccccCCHHHHHhchHHHHHHHHHHcCCCCCCccccchhhhhHhhhcccCccc
Q 024159          157 GDVFKWKHLWKALAEQFEIENYGFGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYL  236 (271)
Q Consensus       157 g~~~s~~~l~~~i~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gl~~~~~~~~~~w~~~d~~~~~~~~~~  236 (271)
                      +.+.+-.|+++.|++.||...+.-        -.+..++.++              ++.                -.+..
T Consensus       246 ~~E~~Nlevv~~i~~~l~~~~~~~--------~~li~~V~DR--------------pGH----------------D~RYa  287 (340)
T COG1088         246 GNERTNLEVVKTICELLGKDKPDY--------RDLITFVEDR--------------PGH----------------DRRYA  287 (340)
T ss_pred             CccchHHHHHHHHHHHhCccccch--------hhheEeccCC--------------CCC----------------cccee
Confidence            999999999999999999754421        1223455444              111                11567


Q ss_pred             cchhHHH-HcCCCCccchHHHHHHHHHHHHhCCC
Q 024159          237 VSMNKSK-EHGFLGFRNSKNSFVTWIGRLKSHRI  269 (271)
Q Consensus       237 ~d~~Kar-~lGf~p~~~~~egl~~~~~~~~~~~~  269 (271)
                      +|.+|++ +|||.|.+++++||++|++||.+.++
T Consensus       288 id~~Ki~~eLgW~P~~~fe~GlrkTv~WY~~N~~  321 (340)
T COG1088         288 IDASKIKRELGWRPQETFETGLRKTVDWYLDNEW  321 (340)
T ss_pred             echHHHhhhcCCCcCCCHHHHHHHHHHHHHhchH
Confidence            7999975 68999999999999999999998753

>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional	Back alignment and domain information

>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional	Back alignment and domain information

>PLN02166 dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PLN02572 UDP-sulfoquinovose synthase	Back alignment and domain information

>PLN02427 UDP-apiose/xylose synthase	Back alignment and domain information

>PLN00016 RNA-binding protein; Provisional	Back alignment and domain information

>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase	Back alignment and domain information

>PLN02206 UDP-glucuronate decarboxylase	Back alignment and domain information

>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional	Back alignment and domain information

>PLN02260 probable rhamnose biosynthetic enzyme	Back alignment and domain information

>PLN02214 cinnamoyl-CoA reductase	Back alignment and domain information

>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated	Back alignment and domain information

>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional	Back alignment and domain information

>PLN02653 GDP-mannose 4,6-dehydratase	Back alignment and domain information

>TIGR01472 gmd GDP-mannose 4,6-dehydratase	Back alignment and domain information

>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>PLN02240 UDP-glucose 4-epimerase	Back alignment and domain information

>PRK10675 UDP-galactose-4-epimerase; Provisional	Back alignment and domain information

>PLN02989 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase	Back alignment and domain information

>PLN00198 anthocyanidin reductase; Provisional	Back alignment and domain information

>TIGR03466 HpnA hopanoid-associated sugar epimerase	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional	Back alignment and domain information

>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PLN02650 dihydroflavonol-4-reductase	Back alignment and domain information

>PLN02986 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PLN02896 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase	Back alignment and domain information

>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase	Back alignment and domain information

>TIGR01179 galE UDP-glucose-4-epimerase	Back alignment and domain information

>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones

Back alignment and domain information

>TIGR01777 yfcH conserved hypothetical protein TIGR01777	Back alignment and domain information

>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PRK07201 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor	Back alignment and domain information

>PLN02686 cinnamoyl-CoA reductase	Back alignment and domain information

>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05865 hypothetical protein; Provisional	Back alignment and domain information

>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1	Back alignment and domain information

>PLN02996 fatty acyl-CoA reductase	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms]	Back alignment and domain information

>TIGR01746 Thioester-redct thioester reductase domain	Back alignment and domain information

>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase	Back alignment and domain information

>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]	Back alignment and domain information

>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02583 cinnamoyl-CoA reductase	Back alignment and domain information

>PLN02778 3,5-epimerase/4-reductase	Back alignment and domain information

>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase	Back alignment and domain information

>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase	Back alignment and domain information

>PLN02503 fatty acyl-CoA reductase 2	Back alignment and domain information

>PLN02260 probable rhamnose biosynthetic enzyme	Back alignment and domain information

>PRK12320 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family	Back alignment and domain information

>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism]	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases	Back alignment and domain information

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion]	Back alignment and domain information

>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase	Back alignment and domain information

>PRK06482 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism]	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PRK08263 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09135 pteridine reductase; Provisional	Back alignment and domain information

>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07806 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG4288 consensus Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK07775 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12746 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PRK06914 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG2774 consensus NAD dependent epimerase [General function prediction only]	Back alignment and domain information

>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PRK08324 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08219 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase	Back alignment and domain information

>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12935 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase	Back alignment and domain information

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06128 oxidoreductase; Provisional	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional	Back alignment and domain information

>PRK06701 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12827 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07577 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK06196 oxidoreductase; Provisional	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06123 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>PRK07069 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK12824 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK06181 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08017 oxidoreductase; Provisional	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09134 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07985 oxidoreductase; Provisional	Back alignment and domain information

>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07041 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05650 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG2910 Putative NADH-flavin reductase [General function prediction only]	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PRK12938 acetyacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06198 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02415 23BDH acetoin reductases	Back alignment and domain information

>PRK12747 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN02253 xanthoxin dehydrogenase	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12744 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK09242 tropinone reductase; Provisional	Back alignment and domain information

>PRK08277 D-mannonate oxidoreductase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		271
2v6f_A		364	Structure Of Progesterone 5beta-Reductase From Digi		1e-101

>pdb|2V6F|A Chain A, Structure Of Progesterone 5beta-Reductase From Digitalis Lanata Length = 364

Back alignment and structure

Iteration: 1

Score = 363 bits (931), Expect = e-101, Method: Compositional matrix adjust. Identities = 174/272 (63%), Positives = 213/272 (78%), Gaps = 5/272 (1%) Query: 1 MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKI-PYDPPFTEDLPRLNIPLFYYN 59 MFRNVL ++IPN PNL+HI LQTG KHY+GPF+ GKI +DPP+TEDLPRL FYY+ Sbjct: 97 MFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMNFYYD 156 Query: 60 QEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTK 119 EDI+ EEVEK+EGLTWS+HRP IFGFSPYS+MN++ TLC+YAAICKHEG L F G K Sbjct: 157 LEDIMLEEVEKKEGLTWSVHRPGNIFGFSPYSMMNLVGTLCVYAAICKHEGKVLRFTGCK 216 Query: 120 ETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYG 179 W+G+S+ SDADLIAE IWAAVD A+NEAFN +NGDVFKWKH WK LAEQF +E Sbjct: 217 AAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVE--- 273 Query: 180 FGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSM 239 G+ ++ ++L + MKGKE VWEEIVREN L PTKL +V +W + D+ L +L SM Sbjct: 274 CGEYEEGVDLKLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWWFGDVILG-NECFLDSM 332 Query: 240 NKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP 271 NKSKEHGFLGFRNSKN+F++WI + K+++IVP Sbjct: 333 NKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP 364

PyMOL of 2v6f

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		271
2v6g_A		364	Progesterone 5-beta-reductase; tyrosine-dependent	7e-92

>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364	Back alignment and structure

 Score =  275 bits (703), Expect = 7e-92
 Identities = 173/272 (63%), Positives = 212/272 (77%), Gaps = 5/272 (1%)

Query: 1   MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKI-PYDPPFTEDLPRLNIPLFYYN 59
           MFRNVL ++IPN PNL+HI LQTG KHY+GPF+  GKI  +DPP+TEDLPRL    FYY+
Sbjct: 97  MFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMNFYYD 156

Query: 60  QEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTK 119
            EDI+ EEVEK+EGLTWS+HRP  IFGFSPYS+MN++ TLC+YAAICKHEG  L F G K
Sbjct: 157 LEDIMLEEVEKKEGLTWSVHRPGNIFGFSPYSMMNLVGTLCVYAAICKHEGKVLRFTGCK 216

Query: 120 ETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYG 179
             W+G+S+ SDADLIAE  IWAAVD  A+NEAFN +NGDVFKWKH WK LAEQF +E   
Sbjct: 217 AAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFNVSNGDVFKWKHFWKVLAEQFGVECGE 276

Query: 180 FGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSM 239
           +   ++   ++L + MKGKE VWEEIVREN L PTKL +V +W + D+ L     +L SM
Sbjct: 277 Y---EEGVDLKLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWWFGDVILG-NECFLDSM 332

Query: 240 NKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP 271
           NKSKEHGFLGFRNSKN+F++WI + K+++IVP
Sbjct: 333 NKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP 364

PyMOL of 2v6g

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		271
2v6g_A		364	Progesterone 5-beta-reductase; tyrosine-dependent	100.0
3m2p_A		311	UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J	99.95
3ehe_A		313	UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC,	99.95
3ruf_A		351	WBGU; rossmann fold, UDP-hexose 4-epimerase, isome	99.95
3ko8_A		312	NAD-dependent epimerase/dehydratase; isomerase, UD	99.95
4b8w_A		319	GDP-L-fucose synthase; oxidoreductase; HET: NAP GD	99.95
4egb_A		346	DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce	99.95
3vps_A		321	TUNA, NAD-dependent epimerase/dehydratase; tunicam	99.94
3enk_A		341	UDP-glucose 4-epimerase; seattle structural genomi	99.94
3slg_A		372	PBGP3 protein; structural genomics, seattle struct	99.94
2p5y_A		311	UDP-glucose 4-epimerase; TTHA0591, structural geno	99.94
1e6u_A		321	GDP-fucose synthetase; epimerase/reductase, SDR, R	99.94
4id9_A		347	Short-chain dehydrogenase/reductase; putative dehy	99.93
2c20_A		330	UDP-glucose 4-epimerase; carbohydrate metabolism,	99.93
3ius_A		286	Uncharacterized conserved protein; APC63810, silic	99.93
1sb8_A		352	WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN	99.93
3gpi_A		286	NAD-dependent epimerase/dehydratase; structural ge	99.93
3sc6_A		287	DTDP-4-dehydrorhamnose reductase; RFBD, structural	99.93
2x4g_A		342	Nucleoside-diphosphate-sugar epimerase; isomerase;	99.93
1ek6_A		348	UDP-galactose 4-epimerase; short-chain dehydrogena	99.93
1eq2_A		310	ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin	99.92
1r6d_A		337	TDP-glucose-4,6-dehydratase; rossmann fold, short-	99.92
2bll_A		345	Protein YFBG; decarboxylase, short chain dehydroge	99.92
3sxp_A		362	ADP-L-glycero-D-mannoheptose-6-epimerase; rossman	99.92
2x6t_A		357	ADP-L-glycero-D-manno-heptose-6-epimerase; isomera	99.92
4b4o_A		298	Epimerase family protein SDR39U1; isomerase; HET:	99.92
2hun_A		336	336AA long hypothetical DTDP-glucose 4,6-dehydrat;	99.92
1gy8_A		397	UDP-galactose 4-epimerase; oxidoreductase; HET: NA	99.92
1rpn_A		335	GDP-mannose 4,6-dehydratase; short-chain dehydroge	99.92
2pk3_A		321	GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor	99.92
2q1s_A		377	Putative nucleotide sugar epimerase/ dehydratase;	99.92
2b69_A		343	UDP-glucuronate decarboxylase 1; UDP-glucoronic ac	99.92
1n2s_A		299	DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold	99.91
1udb_A		338	Epimerase, UDP-galactose-4-epimerase; isomerase; H	99.91
1oc2_A		348	DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos	99.91
1orr_A		347	CDP-tyvelose-2-epimerase; rossmann fold, short-cha	99.91
2yy7_A		312	L-threonine dehydrogenase; thermolabIle, flavobact	99.91
1i24_A		404	Sulfolipid biosynthesis protein SQD1; SDR, short-c	99.9
1kew_A		361	RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo	99.9
1vl0_A		292	DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s	99.9
1rkx_A		357	CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD;	99.9
2c5a_A		379	GDP-mannose-3', 5'-epimerase; short chain dehydrat	99.9
1db3_A		372	GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya	99.9
1t2a_A		375	GDP-mannose 4,6 dehydratase; structural genomics c	99.9
2q1w_A		333	Putative nucleotide sugar epimerase/ dehydratase;	99.9
2ydy_A		315	Methionine adenosyltransferase 2 subunit beta; oxi	99.89
1z45_A		699	GAL10 bifunctional protein; epimerase, mutarotase,	99.89
1n7h_A		381	GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR,	99.88
2hrz_A		342	AGR_C_4963P, nucleoside-diphosphate-sugar epimeras	99.88
3ajr_A		317	NDP-sugar epimerase; L-threonine dehydrogenase, L-	99.88
1z7e_A		660	Protein aRNA; rossmann fold, OB-like fold, hydrola	99.88
2pzm_A		330	Putative nucleotide sugar epimerase/ dehydratase;	99.88
2z1m_A		345	GDP-D-mannose dehydratase; short-chain dehydrogena	99.88
2rh8_A		338	Anthocyanidin reductase; flavonoids, rossmann fold	99.86
2p4h_X		322	Vestitone reductase; NADPH-dependent reductase, is	99.84
2c29_D		337	Dihydroflavonol 4-reductase; flavonoids, short deh	99.84
3oh8_A		516	Nucleoside-diphosphate sugar epimerase (SULA FAMI;	99.84
1y1p_A		342	ARII, aldehyde reductase II; rossmann fold, short	99.79
4f6c_A		427	AUSA reductase domain protein; thioester reductase	99.79
4f6l_B		508	AUSA reductase domain protein; thioester reductase	99.78
2ggs_A		273	273AA long hypothetical DTDP-4-dehydrorhamnose red	99.74
2jl1_A		287	Triphenylmethane reductase; oxidoreductase, biorem	99.73
2zcu_A		286	Uncharacterized oxidoreductase YTFG; alpha-beta sa	99.69
4dqv_A		478	Probable peptide synthetase NRP (peptide synthase;	99.68
3st7_A		369	Capsular polysaccharide synthesis enzyme CAP5F; ro	99.62
3i6i_A		346	Putative leucoanthocyanidin reductase 1; rossmann	99.58
3dhn_A		227	NAD-dependent epimerase/dehydratase; reductase, PF	99.57
3ay3_A		267	NAD-dependent epimerase/dehydratase; glucuronic ac	99.46
3e48_A		289	Putative nucleoside-diphosphate-sugar epimerase; a	99.44
3nzo_A		399	UDP-N-acetylglucosamine 4,6-dehydratase; structura	99.4
3ew7_A		221	LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend	99.4
3dqp_A		219	Oxidoreductase YLBE; alpha-beta protein., structur	99.37
3h2s_A		224	Putative NADH-flavin reductase; Q03B84, NESG, LCR1	99.36
2gn4_A		344	FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann	99.33
1xq6_A		253	Unknown protein; structural genomics, protein stru	99.31
3e8x_A		236	Putative NAD-dependent epimerase/dehydratase; stru	99.31
2wm3_A		299	NMRA-like family domain containing protein 1; unkn	99.23
1qyd_A		313	Pinoresinol-lariciresinol reductase; NADPH-depende	99.22
1xgk_A		352	Nitrogen metabolite repression regulator NMRA; ros	99.2
1qyc_A		308	Phenylcoumaran benzylic ether reductase PT1; NADPH	99.15
2a35_A		215	Hypothetical protein PA4017; alpha-beta-alpha sand	99.13
2gas_A		307	Isoflavone reductase; NADPH-dependent reductase, o	99.11
3c1o_A		321	Eugenol synthase; phenylpropene, PIP reductase, sh	99.11
3rft_A		267	Uronate dehydrogenase; apoenzyme, rossmann fold, N	99.11
2r6j_A		318	Eugenol synthase 1; phenylpropene, PIP reductase,	99.11
1hdo_A		206	Biliverdin IX beta reductase; foetal metabolism, H	98.99
3qvo_A		236	NMRA family protein; structural genomics, PSI-biol	98.7
2bka_A		242	CC3, TAT-interacting protein TIP30; NADPH, PEG600,	98.38
2dkn_A		255	3-alpha-hydroxysteroid dehydrogenase; oxidoreducta	98.29
3r6d_A		221	NAD-dependent epimerase/dehydratase; structural ge	98.16
2bgk_A		278	Rhizome secoisolariciresinol dehydrogenase; oxidor	98.12
3m1a_A		281	Putative dehydrogenase; short, PSI, MCSG, structur	97.79
2yut_A		207	Putative short-chain oxidoreductase; alpha and bet	97.63
1fmc_A		255	7 alpha-hydroxysteroid dehydrogenase; short-chain	97.53
3d7l_A		202	LIN1944 protein; APC89317, structural genomics, PS	97.39
1w6u_A		302	2,4-dienoyl-COA reductase, mitochondrial precursor	97.38
1uay_A		242	Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid	97.3
1cyd_A		244	Carbonyl reductase; short-chain dehydrogenase, oxi	97.28
1spx_A		278	Short-chain reductase family member (5L265); paral	97.26
3un1_A		260	Probable oxidoreductase; structural genomics, PSI-	97.14
3ai3_A		263	NADPH-sorbose reductase; rossmann-fold, NADPH-depe	97.07
1zk4_A		251	R-specific alcohol dehydrogenase; short chain redu	97.03
2cfc_A		250	2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor	96.99
2ph3_A		245	3-oxoacyl-[acyl carrier protein] reductase; TTHA04	96.96
2pd6_A		264	Estradiol 17-beta-dehydrogenase 8; short-chain deh	96.95
3svt_A		281	Short-chain type dehydrogenase/reductase; ssgcid,	96.94
2wsb_A		254	Galactitol dehydrogenase; oxidoreductase, SDR, ros	96.86
3d3w_A		244	L-xylulose reductase; uronate cycle, short-chain d	96.85
2gdz_A		267	NAD+-dependent 15-hydroxyprostaglandin dehydrogen;	96.82
4e6p_A		259	Probable sorbitol dehydrogenase (L-iditol 2-dehyd;	96.73
3awd_A		260	GOX2181, putative polyol dehydrogenase; oxidoreduc	96.71
2zat_A		260	Dehydrogenase/reductase SDR family member 4; alpha	96.69
3qiv_A		253	Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR	96.69
1ja9_A		274	4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p	96.68
1edo_A		244	Beta-keto acyl carrier protein reductase; nucleoti	96.65
2pnf_A		248	3-oxoacyl-[acyl-carrier-protein] reductase; short	96.64
1xq1_A		266	Putative tropinone reducatse; structural genomics,	96.62
1h5q_A		265	NADP-dependent mannitol dehydrogenase; oxidoreduct	96.55
2q2v_A		255	Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore	96.53
2hq1_A		247	Glucose/ribitol dehydrogenase; CTH-1438, structura	96.51
1o5i_A		249	3-oxoacyl-(acyl carrier protein) reductase; TM1169	96.5
3f9i_A		249	3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto	96.43
3afn_B		258	Carbonyl reductase; alpha/beta/alpha, rossmann-fol	96.42
1nff_A		260	Putative oxidoreductase RV2002; directed evolution	96.37
2c07_A		285	3-oxoacyl-(acyl-carrier protein) reductase; oxidor	96.26
4e3z_A		272	Putative oxidoreductase protein; PSI-biology, stru	96.24
1fjh_A		257	3alpha-hydroxysteroid dehydrogenase/carbonyl reduc	96.24
3pxx_A		287	Carveol dehydrogenase; structural genomics, seattl	96.17
2wyu_A		261	Enoyl-[acyl carrier protein] reductase; oxidoreduc	96.15
4dmm_A		269	3-oxoacyl-[acyl-carrier-protein] reductase; rossma	96.11
3uce_A		223	Dehydrogenase; rossmann fold, oxidoreductase; HET:	96.1
3i4f_A		264	3-oxoacyl-[acyl-carrier protein] reductase; struct	96.08
3osu_A		246	3-oxoacyl-[acyl-carrier-protein] reductase; struct	96.0
3r3s_A		294	Oxidoreductase; structural genomics, csgid, center	95.98
3s55_A		281	Putative short-chain dehydrogenase/reductase; stru	95.96
3lyl_A		247	3-oxoacyl-(acyl-carrier-protein) reductase; alpha	95.93
1gee_A		261	Glucose 1-dehydrogenase; short-chain dehydrogenase	95.93
3tpc_A		257	Short chain alcohol dehydrogenase-related dehydro;	95.75
1qsg_A		265	Enoyl-[acyl-carrier-protein] reductase; enoyl redu	95.74
3rd5_A		291	Mypaa.01249.C; ssgcid, structural genomics, seattl	95.74
3tzq_B		271	Short-chain type dehydrogenase/reductase; ssgcid,	95.73
1y7t_A		327	Malate dehydrogenase; NAD-dependent-MDH-NADPH comp	95.65
1mxh_A		276	Pteridine reductase 2; SDR topology, protein-subst	95.57
2ae2_A		260	Protein (tropinone reductase-II); oxidoreductase,	95.55
2z1n_A		260	Dehydrogenase; reductase, SDR, oxidoreductase; 1.8	95.54
3sx2_A		278	Putative 3-ketoacyl-(acyl-carrier-protein) reduct;	95.49
2o23_A		265	HADH2 protein; HSD17B10, schad, ERAB, type II HADH	95.46
3uxy_A		266	Short-chain dehydrogenase/reductase SDR; structura	95.45
3v2h_A		281	D-beta-hydroxybutyrate dehydrogenase; structural g	95.43
3gk3_A		269	Acetoacetyl-COA reductase; acetoacetyl-CO reductas	95.43
1hxh_A		253	3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b	95.42
1hdc_A		254	3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi	95.42
3ak4_A		263	NADH-dependent quinuclidinone reductase; SDR, (R)-	95.41
3uf0_A		273	Short-chain dehydrogenase/reductase SDR; gluconate	95.38
3pgx_A		280	Carveol dehydrogenase; structural genomics, seattl	95.34
3ek2_A		271	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	95.33
1sby_A		254	Alcohol dehydrogenase; ternary complex, NAD, trifl	95.3
3gem_A		260	Short chain dehydrogenase; structural genomics, AP	95.27
2ag5_A		246	DHRS6, dehydrogenase/reductase (SDR family) member	95.22
4eso_A		255	Putative oxidoreductase; NADP, structural genomics	95.2
3ezl_A		256	Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA	95.08
3ppi_A		281	3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de	95.03
3oid_A		258	Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa	95.0
3orf_A		251	Dihydropteridine reductase; alpha-beta-alpha sandw	95.0
2d1y_A		256	Hypothetical protein TT0321; strucrtural genomics,	94.97
3o38_A		266	Short chain dehydrogenase; tuberculosis, ortholog	94.93
3grp_A		266	3-oxoacyl-(acyl carrierprotein) reductase; structu	94.9
2p91_A		285	Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD	94.88
1x1t_A		260	D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S	94.72
4iiu_A		267	3-oxoacyl-[acyl-carrier protein] reductase; struct	94.69
3gaf_A		256	7-alpha-hydroxysteroid dehydrogenase; seattle stru	94.66
3e9n_A		245	Putative short-chain dehydrogenase/reductase; stru	94.63
2rhc_B		277	Actinorhodin polyketide ketoreductase; oxidoreduct	94.62
3pk0_A		262	Short-chain dehydrogenase/reductase SDR; ssgcid, s	94.57
2ekp_A		239	2-deoxy-D-gluconate 3-dehydrogenase; structural ge	94.52
1ae1_A		273	Tropinone reductase-I; oxidoreductase, tropane alk	94.52
3tox_A		280	Short chain dehydrogenase; structural genomics, PS	94.51
1wma_A		276	Carbonyl reductase [NADPH] 1; oxidoreductase; HET:	94.49
2bd0_A		244	Sepiapterin reductase; oxidoreductase; HET: NAP BI	94.42
3n74_A		261	3-ketoacyl-(acyl-carrier-protein) reductase; seatt	94.39
1yo6_A		250	Putative carbonyl reductase sniffer; tyrosine-depe	94.38
2fwm_X		250	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e	94.37
4da9_A		280	Short-chain dehydrogenase/reductase; structural ge	94.36
3k31_A		296	Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI	94.3
2uvd_A		246	3-oxoacyl-(acyl-carrier-protein) reductase; beta-k	94.2
3ctm_A		279	Carbonyl reductase; alcohol dehydrogenase, short-c	94.17
3ftp_A		270	3-oxoacyl-[acyl-carrier protein] reductase; ssgcid	94.17
3ijr_A		291	Oxidoreductase, short chain dehydrogenase/reducta;	94.17
1xhl_A		297	Short-chain dehydrogenase/reductase family member	94.16
3oig_A		266	Enoyl-[acyl-carrier-protein] reductase [NADH]; fat	94.11
4iin_A		271	3-ketoacyl-acyl carrier protein reductase (FABG);	94.09
3tl3_A		257	Short-chain type dehydrogenase/reductase; ssgcid,	94.08
4dqx_A		277	Probable oxidoreductase protein; structural genomi	94.02
2dtx_A		264	Glucose 1-dehydrogenase related protein; rossmann	93.72
4e4y_A		244	Short chain dehydrogenase family protein; structur	93.58
3icc_A		255	Putative 3-oxoacyl-(acyl carrier protein) reducta;	93.57
3kzv_A		254	Uncharacterized oxidoreductase YIR035C; cytoplasmi	93.57
3grk_A		293	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	93.46
3ucx_A		264	Short chain dehydrogenase; ssgcid, seattle structu	93.46
3cxt_A		291	Dehydrogenase with different specificities; rossma	93.38
1iy8_A		267	Levodione reductase; oxidoreductase; HET: NAD; 1.6	93.37
1uls_A		245	Putative 3-oxoacyl-acyl carrier protein reductase;	93.32
3rih_A		293	Short chain dehydrogenase or reductase; structural	93.3
1xkq_A		280	Short-chain reductase family member (5D234); parra	93.25
1uzm_A		247	3-oxoacyl-[acyl-carrier protein] reductase; beta-k	93.25
2b4q_A		276	Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier	93.22
3vtz_A		269	Glucose 1-dehydrogenase; rossmann fold, oxidoreduc	93.22
3op4_A		248	3-oxoacyl-[acyl-carrier protein] reductase; 3-keto	93.11
3gvc_A		277	Oxidoreductase, probable short-chain type dehydrog	93.07
1zmt_A		254	Haloalcohol dehalogenase HHEC; halohydrin dehaloge	93.0
2ew8_A		249	(S)-1-phenylethanol dehydrogenase; transferase; 2.	93.0
4ibo_A		271	Gluconate dehydrogenase; enzyme function initiativ	92.92
2a4k_A		263	3-oxoacyl-[acyl carrier protein] reductase; reduct	92.88
3imf_A		257	Short chain dehydrogenase; structural genomics, in	92.77
3nrc_A		280	Enoyl-[acyl-carrier-protein] reductase (NADH); ros	92.66
3v8b_A		283	Putative dehydrogenase, possibly 3-oxoacyl-[acyl-	92.52
3t4x_A		267	Oxidoreductase, short chain dehydrogenase/reducta;	92.29
3qlj_A		322	Short chain dehydrogenase; structural genomics, se	92.05
1yxm_A		303	Pecra, peroxisomal trans 2-enoyl COA reductase; pe	91.9
3v2g_A		271	3-oxoacyl-[acyl-carrier-protein] reductase; struct	91.6
4egf_A		266	L-xylulose reductase; structural genomics, ssgcid,	91.57
3r1i_A		276	Short-chain type dehydrogenase/reductase; structur	91.33
2pd4_A		275	Enoyl-[acyl-carrier-protein] reductase [NADH]; ant	91.22
1g0o_A		283	Trihydroxynaphthalene reductase; protein-NADPH-act	91.03
3u9l_A		324	3-oxoacyl-[acyl-carrier-protein] reductase; struct	91.03
3uve_A		286	Carveol dehydrogenase ((+)-trans-carveol dehydrog;	90.92
3edm_A		259	Short chain dehydrogenase; structural genomics, ox	90.89
4fc7_A		277	Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman	90.86
3sju_A		279	Keto reductase; short-chain dehydrogenase, oxidore	90.67
1geg_A		256	Acetoin reductase; SDR family, oxidoreductase; HET	90.66
3tsc_A		277	Putative oxidoreductase; structural genomics, seat	90.59
2qhx_A		328	Pteridine reductase 1; oxidoreductase, short-chain	90.57
3t7c_A		299	Carveol dehydrogenase; structural genomics, seattl	90.55
3oec_A		317	Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO;	90.48
4dyv_A		272	Short-chain dehydrogenase/reductase SDR; structura	89.81
1vl8_A		267	Gluconate 5-dehydrogenase; TM0441, structural geno	89.55
3p19_A		266	BFPVVD8, putative blue fluorescent protein; rossma	89.24
3a28_C		258	L-2.3-butanediol dehydrogenase; chiral substrate r	89.17
2x9g_A		288	PTR1, pteridine reductase; short chain dehydrogena	88.73
3tjr_A		301	Short chain dehydrogenase; structural genomics, se	87.99
3lf2_A		265	Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross	87.86
3dii_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	87.81
2ehd_A		234	Oxidoreductase, oxidoreductase, short-chain dehydr	87.66
1sny_A		267	Sniffer CG10964-PA; alpha and beta protein, rossma	87.65
1yb1_A		272	17-beta-hydroxysteroid dehydrogenase type XI; shor	87.52
3f1l_A		252	Uncharacterized oxidoreductase YCIK; E. coli, NADP	87.03
3ksu_A		262	3-oxoacyl-acyl carrier protein reductase; structur	87.01
3u5t_A		267	3-oxoacyl-[acyl-carrier-protein] reductase; struct	86.92
3is3_A		270	17BETA-hydroxysteroid dehydrogenase; short chain d	86.77
1d7o_A		297	Enoyl-[acyl-carrier protein] reductase (NADH) PRE;	86.73
2nm0_A		253	Probable 3-oxacyl-(acyl-carrier-protein) reductas;	86.47
1ooe_A		236	Dihydropteridine reductase; structural genomics, P	86.11
2fr1_A		486	Erythromycin synthase, eryai; short chain dehydrog	85.83
3rku_A		287	Oxidoreductase YMR226C; substrate fingerprint, sho	85.14
3rwb_A		247	TPLDH, pyridoxal 4-dehydrogenase; short chain dehy	85.03
3gdg_A		267	Probable NADP-dependent mannitol dehydrogenase; ro	83.9
3ioy_A		319	Short-chain dehydrogenase/reductase SDR; structura	83.6
3u0b_A		454	Oxidoreductase, short chain dehydrogenase/reducta	83.18
1zmo_A		244	Halohydrin dehalogenase; haloalcohol dehalogenase,	82.54
4imr_A		275	3-oxoacyl-(acyl-carrier-protein) reductase; oxidor	81.6
1xg5_A		279	ARPG836; short chain dehydrogenase, human, SGC, st	80.22
1gz6_A		319	Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF	80.12

>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A*	Back alignment and structure

Probab=100.00  E-value=5.6e-35  Score=264.13  Aligned_cols=258  Identities=61%  Similarity=1.073  Sum_probs=208.0

Q ss_pred             HHHHHHHhccCCCCceEEE-------EEeCCceeccccccCCCCCCCCCCCCCCCCCCCCCCcHHHHHHHHHHHhhcCC-
Q 024159            2 FRNVLRSIIPNAPNLRHIC-------LQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREG-   73 (271)
Q Consensus         2 ~~nll~a~~~~~~~l~r~v-------~~Ss~~vYG~~~~~~g~~~~~~P~~E~~p~~p~p~~~y~~e~~l~~~~~~~~~-   73 (271)
                      +.|+++++.+.+++++||+       |+||..+||..  .    ....|++|++|..|.++.||.+|+++.+++ +..+ 
T Consensus        98 ~~~l~~a~~~~~~~~~~~v~~~g~~i~~Ss~~vyg~~--~----~~~~~~~E~~~~~~~~~~y~~~E~~~~~~~-~~~~~  170 (364)
T 2v6g_A           98 FRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKI--E----SHDPPYTEDLPRLKYMNFYYDLEDIMLEEV-EKKEG  170 (364)
T ss_dssp             HHHHHHHHTTTCTTCCEEEEECCTHHHHCCGGGTTTS--C----CCCSSBCTTSCCCSSCCHHHHHHHHHHHHH-TTSTT
T ss_pred             HHHHHHHHHHhccccceEEeccCceEEEechhhcccc--c----cCCCCCCccccCCccchhhHHHHHHHHHHh-hcCCC
Confidence            5799999998656799998       67777888742  0    123588999887664456889999999887 6666 


Q ss_pred             ceEEEecCCceeccCCCchhhHHHHHHHHHHHHHHhCCCeeeCCCccccccccccccHHHHHHHHHHHhcCCCCCCceee
Q 024159           74 LTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFN  153 (271)
Q Consensus        74 ~~~~ilRP~~VyG~~~~~~~~~~~~~~i~~~~~r~~g~pl~~~G~~~~~~~~~~~~~v~~la~a~i~a~~~~~~~ge~fN  153 (271)
                      ++++|+||++||||++.+..+.+.+.+++..+++..|.++.++|++..|....++++++|+|++++.+++++...|++||
T Consensus       171 ~~~~ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~~~~~~~~~~v~Dva~a~~~~~~~~~~~g~~~n  250 (364)
T 2v6g_A          171 LTWSVHRPGNIFGFSPYSMMNLVGTLCVYAAICKHEGKVLRFTGCKAAWDGYSDCSDADLIAEHHIWAAVDPYAKNEAFN  250 (364)
T ss_dssp             CEEEEEEESSEECCCTTCSSCHHHHHHHHHHHHHHHTCCBCCCSCHHHHHSCBCCEEHHHHHHHHHHHHHCGGGTTEEEE
T ss_pred             ceEEEECCCceeCCCCCcccchHHHHHHHHHHHHhcCCceecCCCcccccccCCCCcHHHHHHHHHHHHhCCCCCCceEE
Confidence            99999999999999876555555666666666434588888889887666788999999999999999988766799999


Q ss_pred             ccCCCcccHHHHHHHHHHHhccccCCCCCCcccccCCHHHHHhchHHHHHHHHHHcCCCCCCccccchhhhhHhhhcccC
Q 024159          154 CTNGDVFKWKHLWKALAEQFEIENYGFGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGA  233 (271)
Q Consensus       154 i~dg~~~s~~~l~~~i~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gl~~~~~~~~~~w~~~d~~~~~~~  233 (271)
                      |++++.+|+.|+++.|++.+|.+....+ +  ..|.++.++++...+.|+.+.++.|+.+..+.++..|.+.+..++  .
T Consensus       251 i~~~~~~s~~e~~~~i~~~~g~~~~~~~-~--~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~  325 (364)
T 2v6g_A          251 VSNGDVFKWKHFWKVLAEQFGVECGEYE-E--GVDLKLQDLMKGKEPVWEEIVRENGLTPTKLKDVGIWWFGDVILG--N  325 (364)
T ss_dssp             ECCSCCBCHHHHHHHHHHHHTCCBCCCC-T--TCCCCHHHHTTTCHHHHHHHHHHTTCCCCCHHHHCCHHHHHHHHT--S
T ss_pred             ecCCCcCCHHHHHHHHHHHhCCCCCCCC-C--CCCccHHHHHhhhHHHHHHHHHHhCCCccccccccccchhhhccc--c
Confidence            9999999999999999999998754320 0  157788888888888999999888876665545446766666664  3


Q ss_pred             c-cccchhHHHHcCCCCccchHHHHHHHHHHHHhCCCCC
Q 024159          234 G-YLVSMNKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP  271 (271)
Q Consensus       234 ~-~~~d~~Kar~lGf~p~~~~~egl~~~~~~~~~~~~iP  271 (271)
                      + ..+|++|++++||+|..+++|+++++++||++.|+||
T Consensus       326 ~~~~~d~~k~~~lG~~p~~~~~e~l~~~~~~~~~~g~lp  364 (364)
T 2v6g_A          326 ECFLDSMNKSKEHGFLGFRNSKNAFISWIDKAKAYKIVP  364 (364)
T ss_dssp             CCCCBCCHHHHHTTCCCCCCHHHHHHHHHHHHHHTTSCC
T ss_pred             chhhcchHHHHhcCCCCCCCHHHHHHHHHHHHHHcCCCC
Confidence            5 5889999998999999999999999999999999998

PyMOL of 2v6g

>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus}	Back alignment and structure

>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0	Back alignment and structure

>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A*	Back alignment and structure

>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A*	Back alignment and structure

>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens}	Back alignment and structure

>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis}	Back alignment and structure

>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis}	Back alignment and structure

>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei}	Back alignment and structure

>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A*	Back alignment and structure

>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A*	Back alignment and structure

>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A*	Back alignment and structure

>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis}	Back alignment and structure

>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3}	Back alignment and structure

>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A*	Back alignment and structure

>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT}	Back alignment and structure

>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0	Back alignment and structure

>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa}	Back alignment and structure

>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A*	Back alignment and structure

>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2	Back alignment and structure

>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A*	Back alignment and structure

>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A	Back alignment and structure

>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori}	Back alignment and structure

>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A*	Back alignment and structure

>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens}	Back alignment and structure

>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A*	Back alignment and structure

>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus}	Back alignment and structure

>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A*	Back alignment and structure

>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A*	Back alignment and structure

>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A*	Back alignment and structure

>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A*	Back alignment and structure

>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A*	Back alignment and structure

>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2	Back alignment and structure

>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris}	Back alignment and structure

>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A*	Back alignment and structure

>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A*	Back alignment and structure

>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2	Back alignment and structure

>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A*	Back alignment and structure

>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A*	Back alignment and structure

>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2	Back alignment and structure

>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica}	Back alignment and structure

>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A	Back alignment and structure

>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2	Back alignment and structure

>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A*	Back alignment and structure

>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens}	Back alignment and structure

>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A*	Back alignment and structure

>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1	Back alignment and structure

>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A*	Back alignment and structure

>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A*	Back alignment and structure

>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A	Back alignment and structure

>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa}	Back alignment and structure

>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A*	Back alignment and structure

>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum}	Back alignment and structure

>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A	Back alignment and structure

>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus}	Back alignment and structure

>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus}	Back alignment and structure

>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii}	Back alignment and structure

>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D	Back alignment and structure

>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A*	Back alignment and structure

>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis}	Back alignment and structure

>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A	Back alignment and structure

>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A*	Back alignment and structure

>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens}	Back alignment and structure

>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp}	Back alignment and structure

>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}	Back alignment and structure

>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp}	Back alignment and structure

>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}	Back alignment and structure

>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A*	Back alignment and structure

>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A*	Back alignment and structure

>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}	Back alignment and structure

>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A	Back alignment and structure

>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2	Back alignment and structure

>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A*	Back alignment and structure

>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2	Back alignment and structure

>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2	Back alignment and structure

>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa}	Back alignment and structure

>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri}	Back alignment and structure

>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A*	Back alignment and structure

>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A*	Back alignment and structure

>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*	Back alignment and structure

>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A}	Back alignment and structure

>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A	Back alignment and structure

>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP}	Back alignment and structure

>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A*	Back alignment and structure

>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*	Back alignment and structure

>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis}	Back alignment and structure

>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus}	Back alignment and structure

>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*	Back alignment and structure

>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua}	Back alignment and structure

>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A*	Back alignment and structure

>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2	Back alignment and structure

>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti}	Back alignment and structure

>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A*	Back alignment and structure

>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A	Back alignment and structure

>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus}	Back alignment and structure

>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8}	Back alignment and structure

>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens}	Back alignment and structure

>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans}	Back alignment and structure

>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*	Back alignment and structure

>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*	Back alignment and structure

>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A	Back alignment and structure

>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans}	Back alignment and structure

>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A*	Back alignment and structure

>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp}	Back alignment and structure

>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2	Back alignment and structure

>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G	Back alignment and structure

>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A*	Back alignment and structure

>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A	Back alignment and structure

>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2	Back alignment and structure

>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A	Back alignment and structure

>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum}	Back alignment and structure

>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0	Back alignment and structure

>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A*	Back alignment and structure

>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A*	Back alignment and structure

>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2	Back alignment and structure

>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli}	Back alignment and structure

>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A*	Back alignment and structure

>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A*	Back alignment and structure

>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A*	Back alignment and structure

>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus}	Back alignment and structure

>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0	Back alignment and structure

>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A*	Back alignment and structure

>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp}	Back alignment and structure

>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0	Back alignment and structure

>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2	Back alignment and structure

>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A*	Back alignment and structure

>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti}	Back alignment and structure

>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A*	Back alignment and structure

>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis}	Back alignment and structure

>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0	Back alignment and structure

>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A*	Back alignment and structure

>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A*	Back alignment and structure

>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A*	Back alignment and structure

>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix}	Back alignment and structure

>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp}	Back alignment and structure

>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A*	Back alignment and structure

>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides}	Back alignment and structure

>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti}	Back alignment and structure

>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}	Back alignment and structure

>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2	Back alignment and structure

>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A*	Back alignment and structure

>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens}	Back alignment and structure

>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0	Back alignment and structure

>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2	Back alignment and structure

>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A*	Back alignment and structure

>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV}	Back alignment and structure

>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A	Back alignment and structure

>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium}	Back alignment and structure

>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A*	Back alignment and structure

>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum}	Back alignment and structure

>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}	Back alignment and structure

>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A	Back alignment and structure

>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus}	Back alignment and structure

>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A*	Back alignment and structure

>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A*	Back alignment and structure

>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis}	Back alignment and structure

>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum}	Back alignment and structure

>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A*	Back alignment and structure

>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A	Back alignment and structure

>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2	Back alignment and structure

>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti}	Back alignment and structure

>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A*	Back alignment and structure

>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2	Back alignment and structure

>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus}	Back alignment and structure

>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli}	Back alignment and structure

>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A*	Back alignment and structure

>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis}	Back alignment and structure

>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis}	Back alignment and structure

>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei}	Back alignment and structure

>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A*	Back alignment and structure

>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A*	Back alignment and structure

>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A	Back alignment and structure

>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans}	Back alignment and structure

>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli}	Back alignment and structure

>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A	Back alignment and structure

>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp}	Back alignment and structure

>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str}	Back alignment and structure

>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A*	Back alignment and structure

>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2	Back alignment and structure

>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus}	Back alignment and structure

>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A	Back alignment and structure

>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium}	Back alignment and structure

>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E	Back alignment and structure

>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis}	Back alignment and structure

>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A*	Back alignment and structure

>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A*	Back alignment and structure

>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum}	Back alignment and structure

>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str}	Back alignment and structure

>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A*	Back alignment and structure

>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti}	Back alignment and structure

>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis}	Back alignment and structure

>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium}	Back alignment and structure

>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti}	Back alignment and structure

>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis}	Back alignment and structure

>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum}	Back alignment and structure

>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A*	Back alignment and structure

>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A*	Back alignment and structure

>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti}	Back alignment and structure

>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A*	Back alignment and structure

>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str}	Back alignment and structure

>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A*	Back alignment and structure

>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber}	Back alignment and structure

>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2	Back alignment and structure

>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0	Back alignment and structure

>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2	Back alignment and structure

>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium}	Back alignment and structure

>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile}	Back alignment and structure

>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus}	Back alignment and structure

>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus}	Back alignment and structure

>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum}	Back alignment and structure

>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ...	Back alignment and structure

>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp}	Back alignment and structure

>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A*	Back alignment and structure

>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus}	Back alignment and structure

>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2	Back alignment and structure

>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A	Back alignment and structure

>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1}	Back alignment and structure

>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti}	Back alignment and structure

>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A	Back alignment and structure

>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A*	Back alignment and structure

>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor}	Back alignment and structure

>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A*	Back alignment and structure

>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A*	Back alignment and structure

>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A	Back alignment and structure

>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444}	Back alignment and structure

>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A	Back alignment and structure

>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP}	Back alignment and structure

>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum}	Back alignment and structure

>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		271
d1r6da_		322	dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces	99.96
d1sb8a_		341	UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo	99.96
d1db3a_		357	GDP-mannose 4,6-dehydratase {Escherichia coli [Tax	99.95
d2b69a1		312	UDP-glucuronate decarboxylase 1 {Human (Homo sapie	99.95
d1kewa_		361	dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus	99.93
d2c5aa1		363	GDP-mannose-3', 5'-epimerase {Thale cress (Arabido	99.93
d1e6ua_		315	GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (	99.93
d1rpna_		321	GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos	99.92
d1udca_		338	Uridine diphosphogalactose-4-epimerase (UDP-galact	99.92
d1t2aa_		347	GDP-mannose 4,6-dehydratase {Human (Homo sapiens)	99.91
d2blla1		342	Polymyxin resistance protein ArnA (PrmI) {Escheric	99.91
d1oc2a_		346	dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus	99.91
d1z45a2		347	Uridine diphosphogalactose-4-epimerase (UDP-galact	99.91
d1ek6a_		346	Uridine diphosphogalactose-4-epimerase (UDP-galact	99.9
d1gy8a_		383	Uridine diphosphogalactose-4-epimerase (UDP-galact	99.89
d1n7ha_		339	GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop	99.88
d1i24a_		393	Sulfolipid biosynthesis protein SQD1 {Thale cress	99.86
d1eq2a_		307	ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric	99.83
d1orra_		338	CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId:	99.83
d1vl0a_		281	DTDP-4-dehydrorhamnose reductase RfbD {Clostridium	99.82
d1rkxa_		356	CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc	99.8
d1y1pa1		342	Aldehyde reductase II {Sporobolomyces salmonicolor	99.72
d1n2sa_		298	dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S	99.59
d1qyda_		312	Pinoresinol-lariciresinol reductase {Giant arborvi	99.33
d1qyca_		307	Phenylcoumaran benzylic ether reductase {Loblolly	99.25
d2q46a1		252	Hypothetical protein At5g02240 (T7H20_290) {Thale	99.01
d2a35a1		212	Hypothetical protein PA4017 {Pseudomonas aeruginos	98.75
d1hdoa_		205	Biliverdin IX beta reductase {Human (Homo sapiens)	98.73
d2bkaa1		232	TAT-interacting protein TIP30 {Human (Homo sapiens	98.7
d1xgka_		350	Negative transcriptional regulator NmrA {Aspergill	98.52

>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]

Probab=99.96  E-value=6e-30  Score=226.23  Aligned_cols=202  Identities=12%  Similarity=0.110  Sum_probs=156.9

Q ss_pred             HHHHHHHhccCCCCceEEEEEeCCceeccccccCCCCCCCCCCCCCCCCCCCCCCcHH-----HHHHHHHHHhhcCCceE
Q 024159            2 FRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYN-----QEDILFEEVEKREGLTW   76 (271)
Q Consensus         2 ~~nll~a~~~~~~~l~r~v~~Ss~~vYG~~~~~~g~~~~~~P~~E~~p~~p~p~~~y~-----~e~~l~~~~~~~~~~~~   76 (271)
                      +.|+++++.+.  ++++||++||..+||..        ...|++|++|..|.  +.|+     .|.++..++ +.+++++
T Consensus       107 t~~ll~~~~~~--~~~~~I~~Ss~~~yg~~--------~~~~~~E~~~~~p~--~~Y~~sK~~~E~~~~~~~-~~~~~~~  173 (322)
T d1r6da_         107 TQTLLQCAVDA--GVGRVVHVSTNQVYGSI--------DSGSWTESSPLEPN--SPYAASKAGSDLVARAYH-RTYGLDV  173 (322)
T ss_dssp             HHHHHHHHHHT--TCCEEEEEEEGGGGCCC--------SSSCBCTTSCCCCC--SHHHHHHHHHHHHHHHHH-HHHCCCE
T ss_pred             HHHHHHHHHHc--CCceEEEeecceeecCC--------CCCCCCCCCCCCCC--CHHHHHHHHHHHHHHHHH-HHhCCCE
Confidence            57999999884  68999999999999964        45689999987765  4555     466666665 6779999


Q ss_pred             EEecCCceeccCCCchhhHHHHHHHHHHHHHHhCCCeeeCCCccccccccccccHHHHHHHHHHHhcCCCCCCceeeccC
Q 024159           77 SIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTN  156 (271)
Q Consensus        77 ~ilRP~~VyG~~~~~~~~~~~~~~i~~~~~r~~g~pl~~~G~~~~~~~~~~~~~v~~la~a~i~a~~~~~~~ge~fNi~d  156 (271)
                      +++||++||||++..  +.+.+..+..+   ..|.++.+.|+++   +.+|++|++|+|++++.+++++. .|++||+++
T Consensus       174 ~~lR~~~vyGp~~~~--~~~i~~~i~~~---~~~~~i~v~~~g~---~~r~~i~v~D~a~ai~~~~~~~~-~~~~~ni~~  244 (322)
T d1r6da_         174 RITRCCNNYGPYQHP--EKLIPLFVTNL---LDGGTLPLYGDGA---NVREWVHTDDHCRGIALVLAGGR-AGEIYHIGG  244 (322)
T ss_dssp             EEEEECEEECTTCCT--TSHHHHHHHHH---HTTCCEEEETTSC---CEEEEEEHHHHHHHHHHHHHHCC-TTCEEEECC
T ss_pred             EEEEeeeEECcCCCc--CcHHHHHHHHH---HcCCCcEEecCCC---eEEccEEHHHHHHHHHHHHhCCC-CCCeeEEee
Confidence            999999999998632  12233322222   2478898888887   89999999999999998888763 588999999


Q ss_pred             CCcccHHHHHHHHHHHhccccCCCCCCcccccCCHHHHHhchHHHHHHHHHHcCCCCCCccccchhhhhHhhhcccCccc
Q 024159          157 GDVFKWKHLWKALAEQFEIENYGFGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYL  236 (271)
Q Consensus       157 g~~~s~~~l~~~i~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gl~~~~~~~~~~w~~~d~~~~~~~~~~  236 (271)
                      ++.+|+.|+.+.+++.+|.+.....      ..      ..+             ...+                 .+..
T Consensus       245 ~~~~s~~e~~~~i~~~~~~~~~~~~------~~------~~~-------------~~~~-----------------~~~~  282 (322)
T d1r6da_         245 GLELTNRELTGILLDSLGADWSSVR------KV------ADR-------------KGHD-----------------LRYS  282 (322)
T ss_dssp             CCEEEHHHHHHHHHHHHTCCGGGEE------EE------CCC-------------TTCC-----------------CBCC
T ss_pred             cccchhHHHHHHHHHHhCCCcccee------ec------CCC-------------CCCC-----------------ceee
Confidence            9999999999999999997654220      00      000             0000                 1457


Q ss_pred             cchhHHHH-cCCCCccchHHHHHHHHHHHHhC
Q 024159          237 VSMNKSKE-HGFLGFRNSKNSFVTWIGRLKSH  267 (271)
Q Consensus       237 ~d~~Kar~-lGf~p~~~~~egl~~~~~~~~~~  267 (271)
                      +|++|+++ +||+|.++++||++++++||+++
T Consensus       283 ~d~~k~~~~lg~~p~~~~eegI~~~i~w~~~n  314 (322)
T d1r6da_         283 LDGGKIERELGYRPQVSFADGLARTVRWYREN  314 (322)
T ss_dssp             BCCHHHHHHHCCCCCSCHHHHHHHHHHHHHHC
T ss_pred             eCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHh
Confidence            79999987 69999999999999999999975

PyMOL of d1r6da_

>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]}	Back information, alignment and structure

>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]}	Back information, alignment and structure

>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]}	Back information, alignment and structure

>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]}	Back information, alignment and structure

>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]}	Back information, alignment and structure

>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}	Back information, alignment and structure

>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]}	Back information, alignment and structure

>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]}	Back information, alignment and structure