Citrus Sinensis ID: 024159


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGFGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP
cHHHHHHHHccccccccEEEEECccEEECccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEccccccccccccccHHHHHHHHHHHHHHHccccccccccccHHccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHHHcccHHHHHHHHHHccccccccccccccEEEEEcccccccccccHHHHHHcccccccccHHHHHHHHHHHHHccccc
MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGFG*******MRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYYNQEDILFEEVEKREGLTWSIHRPFGIFGFSPYSLMNIIATLCMYAAICKHEGIPLLFPGTKETWEGFSEYSDADLIAEQQIWAAVDANARNEAFNCTNGDVFKWKHLWKALAEQFEIENYGFGDEKDSERMRLGEFMKGKESVWEEIVRENQLQPTKLNEVAVWSYADMGLNIGAGYLVSMNKSKEHGFLGFRNSKNSFVTWIGRLKSHRIVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-oxo-Delta(4,5)-steroid 5-beta-reductase Involved in vascular strand development. Catalyzes the stereospecific conversion of progesterone to 5-beta-pregnane-3,20-dione. Can use progesterone, testosterone, 21-acetyl cortexone, 2-cyclohexenone, but-1-en-3-one, ethyl acrylate, ethylmethacrylate, cortisone and canarigenone as substrates, lower activity with 3-methyl-2-cyclohexenone and 3,5,5-trimethyl-2-cyclohexenone as substrate, and no activity with canarigenin, canarigenin digitoxoside and pregnenolone. May be involved in the formation of 5-beta phytoecdysteroids.probableQ9STX2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V6G, chain A
Confidence level:very confident
Coverage over the Query: 2-271
View the alignment between query and template
View the model in PyMOL