Citrus Sinensis ID: 024166

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-

MMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYVSALLLVVGLILFTLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPADDKPIKRTATSSFKVNIRKLSFSEREEADEEKRAPV

ccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccccccccccHHHHccccc

*MNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYVSALLLVVGLILFTLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPAD***********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-galactose/UDP-glucose transporter 4	Sugar transporter involved in the transport of nucleotide-sugars from cytoplasm into the Golgi and/or the endoplasmic reticulum.	probable	Q9LDX3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 8-81
View the alignment between query and template
View the model in PyMOL

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 165-234
View the alignment between query and template
View the model in PyMOL