Citrus Sinensis ID: 024182


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MEFPKSQVLTNPLLSLSTFIHQNCLRLGSELSSRLDDTKRTLSRRLQRPPLSVPPFAFLSQPKQALAATLSSDFVSKTLAGTAVYTVSNSSNEFVLISDPNGAKSIGLLCFRQEDAEAFLAQVRLRRKELRSAAKVVPITLDQVYMLKVEGIAFRFLPDPAQIRNALELKAADVRTGFDGVPVFQSELLVVKKKNKRYCPVYFQKEDIEKELSKVSRASRGAGVSQHIMVGSLEDVLKKMETSEKNSGWEDLIFIPPGKSHSQHIQEVAKV
cccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccHHHHHccccHHHHHHHcccccEEEEEcccccEEEEEccccccEEEEEEEcHHHHHHHHHHHHHHccccccccEEEEEEHHHHHHHHcccCEEEECccHHHHHHHHHHHHcccccccccccEEEccEEEEECccCEEEEccccHHHHHHHHHHHHHHcccccccccEEEEEHHHHHHHHHcccccccccCEEEEcccccHHHHHHHHHcc
*********TNPLLSLSTFIHQNCLRLGS***********************VPPFAF********AATLSSDFVSKTLAGTAVYTVSNSSNEFVLISDPNGAKSIGLLCFRQEDAEAFLAQVRLRRKELRSAAKVVPITLDQVYMLKVEGIAFRFLPDPAQIRNALELKAADVRTGFDGVPVFQSELLVVKKKNKRYCPVYFQKEDIEKE*****************MVGSLEDVLKKMETS***SGWEDLIFIPPGKSHSQHIQEVA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFPKSQVLTNPLLSLSTFIHQNCLRLGSELSSRLDDTKRTLSRRLQRPPLSVPPFAFLSQPKQALAATLSSDFVSKTLAGTAVYTVSNSSNEFVLISDPNGAKSIGLLCFRQEDAEAFLAQVRLRRKELRSAAKVVPITLDQVYMLKVEGIAFRFLPDPAQIRNALELKAADVRTGFDGVPVFQSELLVVKKKNKRYCPVYFQKEDIEKELSKVSRASRGAGVSQHIMVGSLEDVLKKMETSEKNSGWEDLIFIPPGKSHSQHIQEVAKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TIC 22, chloroplastic Involved in protein precursor import into chloroplasts. Imported into the intermembrane space via the Toc translocon. May be involved in the import pathway used by proteins without a cleavable N-terminal pre-sequence.probableQ9SZB2
Protein TIC 22, chloroplastic Involved in protein precursor import into chloroplasts. Imported into the intermembrane space via the Toc translocon. May be involved in the import pathway used by proteins without a cleavable N-terminal pre-sequence.probableQ9ZST9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EV1, chain A
Confidence level:very confident
Coverage over the Query: 70-270
View the alignment between query and template
View the model in PyMOL