Citrus Sinensis ID: 024190

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-

MSLAVGALSSSNNMVDEKRDEGENSNVAVGAAEPANLQEEQRTSRYVTVSETDEEDDDDREQDIQLGPQYTLKEQIEKDKDDESLRKWKEQLLGSVDFDNIGETLEPEVRILSLSIVAPGRNDIVLAVPEDGKPAGNWFTLKEGSKYSLKFTFEVSNNIVSGLKYTNTVWKAGIKGKQTTYARTHANFLNVIHSYVLLTTSFISVDSAKQMLGTFSPQPEPYIHEMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFDIRKEWAAV

ccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHccccccccccccccccEEEEEEEEEEcccccEEEEccccccccccEEEEccccEEEEEEEEEEccEEEEccEEEEEEEEccEEcccccccccccccccccccccccccEEEEEcccccccccccccccccEEcccccccccCEEEEEEEEEEEEEECccccEEEEEEEEEEEEEccccc

*******************************************************************************KDDESLRKWKEQLLGSVDFDNIGETLEPEVRILSLSIVAPGRNDIVLAVPEDGKPAGNWFTLKEGSKYSLKFTFEVSNNIVSGLKYTNTVWKAGIKGKQTTYARTHANFLNVIHSYVLLTTSFISVDSAKQMLGTFSPQPEPYIHEMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFDIRKEWA**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Rho GDP-dissociation inhibitor 1	Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.	probable	Q9SFC6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DOA, chain B
Confidence level:very confident
Coverage over the Query: 52-175,205-270
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 31-101
View the alignment between query and template
View the model in PyMOL