Citrus Sinensis ID: 024191

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MAVKRFVHYYRLTKTYKQDFGRFCNLFSTKSDIESRQQFQKWHNGGGIFHQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVALSNCIIGDSCIIHNGVCIGQDGFGFFVDEHGNMLKKPQLLNARIGNHVEIGANSCIDRGSWRDTVIGDHSKIDNLVQIGHNVAIGKSCMLCGQVGIAGSATIGDYVTLGGRVAVRDHVSIASKVRLAANSCVFKDITEPGDYGGFPAVPIHEWRRQVANQIRSSKKRTS
cccccccEEEEEcccHHHHHHHHHHHccccccHHHHHHHccccccccEEccccECccccEEccccEEccccEEccccEEccccEEccccEEccccEEccccEEEcEEEcccEEEccccEEccccccccccccccEEEEcCEEEEEEccccEEccccccccccccccEEccccEEcccEEEEcccEEccccEEEEcEEEEEcEEEcccEEEccEEEEcccEEEccccEEccccccccccccccEEECcccccHHHHHHHHHHHHcccccccc
***KRFVHYYRLTKTYKQDFGRFCNLFSTKSDIESRQQFQKWHNGGGIFHQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVALSNCIIGDSCIIHNGVCIGQDGFGFFVDEHGNMLKKPQLLNARIGNHVEIGANSCIDRGSWRDTVIGDHSKIDNLVQIGHNVAIGKSCMLCGQVGIAGSATIGDYVTLGGRVAVRDHVSIASKVRLAANSCVFKDITEPGDYGGFPAVPIHEWRRQVANQI*SSK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVKRFVHYYRLTKTYKQDFGRFCNLFSTKSDIESRQQFQKWHNGGGIFHQSACIDSTVLIEVGAIVHSKAVLGANVCIGSGTVVGPAVTIGQSTNIGFNVALSNCIIGDSCIIHNGVCIGQDGFGFFVDEHGNMLKKPQLLNARIGNHVEIGANSCIDRGSWRDTVIGDHSKIDNLVQIGHNVAIGKSCMLCGQVGIAGSATIGDYVTLGGRVAVRDHVSIASKVRLAANSCVFKDITEPGDYGGFPAVPIHEWRRQVANQIRSSKKRTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable UDP-3-O-acylglucosamine N-acyltransferase 2, mitochondrial Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell. Catalyzes the N-acylation of UDP-3-O-(hydroxymyristoyl)glucosamine using 3-hydroxymyristoyl-ACP as the acyl donor. Lipid A-like molecules in plants may serve as structural components of the outer membranes of mitochondria and/or chloroplasts, or may be involved in signal transduction or plant defense responses.probableF4JIP6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EH0, chain A
Confidence level:very confident
Coverage over the Query: 14-267
View the alignment between query and template
View the model in PyMOL