Citrus Sinensis ID: 024201


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MACSAASAAATATAALISSNPKAFSSSSISPSQNLTIPRSFSGLRNPLKSQVPRPVSLSRGSRSRKSFVVKASVEIPPLVGNTAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYTEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI
ccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEccccccccEEEEEEcccccCEEccHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHcccccccccccccccEEccccccHHHHcccccccccEEEEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccEEccccccccccccccHHHHHHHHHHc
**************************************************************************EIPPLVGNTAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYTEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACSAASAAATATAALISSNPKAFSSSSISPSQNLTIPRSFSGLRNPLKSQVPRPVSLSRGSRSRKSFVVKASVEIPPLVGNTAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYTEFEKLNTEILGVSTDSVFSHLAWVQTDRKSGGLGDLKYPLIADITKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQYVQENPDEVCPAGWKPGDKSMKPDPKLSKEYFAAI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-Cys peroxiredoxin BAS1, chloroplastic Antioxidant enzyme that reduces hydrogen peroxide in chloroplasts. Participates in a NADPH-dependent hydrogen peroxide scavenging system in chloroplasts by receiving reducing equivalents from the thioredoxin reductase NTRC. May be involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system.confidentQ6ER94
2-Cys peroxiredoxin BAS1-like, chloroplastic May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. Involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system.probableQ9C5R8
Peroxiredoxin-2 Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).probableQ9BGI3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.11.-.-Acting on a peroxide as acceptor.probable
1.11.1.-Peroxidases.probable
1.11.1.15Peroxiredoxin.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QMV, chain A
Confidence level:very confident
Coverage over the Query: 78-270
View the alignment between query and template
View the model in PyMOL