Citrus Sinensis ID: 024274

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270

MMTSSSSSAHAQAVQWGNEETRDLIVIRGETERDLVGIKRNKTIWEIVSVKLRERGYSRTPDQCKCKWKNLVNRYKGKETSDPDSGRQCPFFNELHAVFTERAKNMQRLLAESEAGSMQAKKRFKRLNADELSDEEDDDEEQSEEEEEEEERPARGNSRKRKIERNVSDKSPRATSGTAGIHEMLKAFFDQQQRMEVEWRQMMERRAQERQLFEEEWRQRMEKLERERLLVEQAWREKEEQRRIREESRAERRDALLTTLLTKLINQNNP

cccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccHHHHHcccccccccccccccccccccccHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc

***************WGNEETRDLIVIRGETERDLVGIKRNKTIWEIVSVKLRERGYSRTPDQCKCKWKNLVNRY*************CPFFNELHAVFT************************************************************************************LKAFF*******************************************************************LTTLLT*L******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MMTSSSSSAHAQAVQWGNEETRDLIVIRGETERDLVGIKRNKTIWEIVSVKLRERGYSRTPDQCKCKWKNLVNRYKGKETSDPDSGRQCPFFNELHAVFTERAKNMQRLLAESEAGSMQAKKRFKRLNxxxxxxxxxxxxxxxxxxxxxxxxPARGNSRKRKIERNVSDKSPRATSGTAGIHEMLKAFFDQQQRMEVEWRQMMERRAQERQLFxxxxxxxxxxxxxxxxxxxxxxxxxxxxRRIREESRAERRDALLTTLLTKLINQNNP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Trihelix transcription factor GT-3b	Probable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt.	probable	O80450

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EBI, chain A
Confidence level:very confident
Coverage over the Query: 11-94
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 95-150
View the alignment between query and template
View the model in PyMOL