Citrus Sinensis ID: 024284


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MATNIGMMDSAYFVGRNELLTWINNRLQLHLSRIEEAASGAVQCQMLDMTYPGVVPMHKVNFDAKTEYDMIQNYKVLQDVFNKLKIEKHIEVNKLVKGRPLDNLEFLQWLKRYCDSVNGGIMNENYNPVERRCKGGKERSSRGSQKISKSLQTNNMHNAGSGDIGHSKISGPRQAKIYGANSAQEVQALSKEITDLKLSVDLLEKERDFYFAKLRDIEILCQTPELENLPVRISGLLILIILHFSLFFFFWNDLFPVSLFAWIPKDPRN
cccEEECccccccccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccc
*ATNIGMMDSAYFVGRNELLTWINNRLQLHLSRIEEAASGAVQCQMLDMTYPGVVPMHKVNFDAKTEYDMIQNYKVLQDVFNKLKIEKHIEVNKLVKGRPLDNLEFLQWLKRYCDSVNGGIMNENY**************************************************************LSKEITDLKLSVDLLEKERDFYFAKLRDIEILCQTPELENLPVRISGLLILIILHFSLFFFFWNDLFPVSLFAWI******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATNIGMMDSAYFVGRNELLTWINNRLQLHLSRIEEAASGAVQCQMLDMTYPGVVPMHKVNFDAKTEYDMIQNYKVLQDVFNKLKIEKHIEVNKLVKGRPLDNLEFLQWLKRYCDSVNGGIMNENYNPVERRCKGGKERSSRGSQKISKSLQTNNMHNAGSGDIGHSKISGPRQAKIYGANSAQExxxxxxxxxxxxxxxxxxxxxRDFYFAKLRDIEILCQTPELENLPVRISGLLILIILHFSLFFFFWNDLFPVSLFAWIPKDPRN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microtubule-associated protein RP/EB family member 1A Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. May be involved in anchoring microtubules to their nucleation sites and/or functioning as a reservoir for distribution to the growing end. In plants, microtubule minus ends are not necessarily severed from the nucleation site and transported to the plus end of a microtubule as part of the recycling process. May play a role in endomembrane organization during polarized growth of plant cells. Interacts with the tobamovirus movement protein (MP) and may play a role in the association of MP with the microtubule system during infection.confidentQ7XJ60
Microtubule-associated protein RP/EB family member 1B Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. May be involved in anchoring microtubules to their nucleation sites and/or functioning as a reservoir for distribution to the growing end. In plants, microtubule minus ends are not necessarily severed from the nucleation site and transported to the plus end of a microtubule as part of the recycling process. May play a role in endomembrane organization during polarized growth of plant cells.probableQ9FJJ5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WYO, chain A
Confidence level:very confident
Coverage over the Query: 1-135
View the alignment between query and template
View the model in PyMOL
Template: 2R8U, chain A
Confidence level:very confident
Coverage over the Query: 1-133
View the alignment between query and template
View the model in PyMOL