Citrus Sinensis ID: 024292

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAARLKTS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEcccccccccccccccHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHccccEEEcccccccccccHHHccHHHHHHHHccEEEEcccccccccccccccccc
ccEEEcccccccccccccccccccccccccccccccEEEEccccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEccHHHcccccccccHHHHHHHHHHHHccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHccccEEEEccccEEEcccHHHHHHHHHHHHcccEEEEccccccccEEEccccccc
mamhvsgacfsvfsgsrvgnIRAVASEGFATVKTAEDkvklggsdlkvtklgvgawswgdtsywnnfqwdDRKMKAAKAAFDtsldngitffdtaevygsrasfgainsETLLGRFIKerkqrdpevEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWagiwgnegfidgLGDAVEQGLVKAvgvsnyseKRLRNAYEKLKKrgiplasnqvnysliyrkpeengvkAACDELGITLIAycpiaqdspIFAARLKTS
MAMHVSGACFsvfsgsrvgNIRAVASegfatvktaedkvklggsdlkvtklgvgawswgdTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVygsrasfgainsetLLGRFIKErkqrdpevevtvatkfaalpwrlGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKavgvsnysekrLRNAYEklkkrgiplasnqvnySLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAARLKTS
MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAARLKTS
******GACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFA******
**********************************AEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAARL***
MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKER********VTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAARLKTS
********CFSVFSGSRVG****V*S******KTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAAR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAARLKTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
Q94A68377 Uncharacterized oxidoredu yes no 0.881 0.628 0.806 1e-110
Q56Y42365 Pyridoxal reductase,chlor no no 0.754 0.556 0.420 1e-38
P77735324 Uncharacterized oxidoredu N/A no 0.762 0.632 0.309 6e-19
A2XRZ6 355 Probable aldo-keto reduct N/A no 0.747 0.566 0.306 2e-15
P63485 323 Uncharacterized oxidoredu yes no 0.687 0.572 0.344 9e-15
P63484 323 Uncharacterized oxidoredu yes no 0.687 0.572 0.344 9e-15
Q9P7U2351 Putative aryl-alcohol deh yes no 0.747 0.572 0.304 1e-14
Q3L181 337 Perakine reductase OS=Rau N/A no 0.739 0.590 0.298 2e-14
P80874 331 General stress protein 69 yes no 0.698 0.567 0.296 2e-14
C6TBN2 346 Probable aldo-keto reduct no no 0.732 0.569 0.303 8e-14
>sp|Q94A68|Y1669_ARATH Uncharacterized oxidoreductase At1g06690, chloroplastic OS=Arabidopsis thaliana GN=At1g06690 PE=1 SV=1 Back     alignment and function desciption
 Score =  398 bits (1023), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/238 (80%), Positives = 213/238 (89%), Gaps = 1/238 (0%)

Query: 21  IRAVAS-EGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKA 79
           +RAVAS +  A   + E KVKLGGSDLKVTKLG+G WSWGD SYWN+FQWDDRK+KAAK 
Sbjct: 30  VRAVASGDSVAPAISEESKVKLGGSDLKVTKLGIGVWSWGDNSYWNDFQWDDRKLKAAKG 89

Query: 80  AFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALP 139
           AFDTSLDNGI FFDTAEVYGS+ S GAI+SETLLGRFI+ERK+R P  EV+VATKFAALP
Sbjct: 90  AFDTSLDNGIDFFDTAEVYGSKFSLGAISSETLLGRFIRERKERYPGAEVSVATKFAALP 149

Query: 140 WRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSN 199
           WR GR+SV+ ALKDSL RL LSSV+LYQLHW G+WGNEG++DGLGDAVEQGLVKAVGVSN
Sbjct: 150 WRFGRESVVTALKDSLSRLELSSVDLYQLHWPGLWGNEGYLDGLGDAVEQGLVKAVGVSN 209

Query: 200 YSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQ 257
           YSEKRLR+AYE+LKKRGIPLASNQVNYSLIYR PE+ GVKAACDELG+TLIAY PIAQ
Sbjct: 210 YSEKRLRDAYERLKKRGIPLASNQVNYSLIYRAPEQTGVKAACDELGVTLIAYSPIAQ 267

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q56Y42|PLR1_ARATH Pyridoxal reductase,chloroplastic OS=Arabidopsis thaliana GN=PLR1 PE=1 SV=1 Back     alignment and function description
>sp|P77735|YAJO_ECOLI Uncharacterized oxidoreductase YajO OS=Escherichia coli (strain K12) GN=yajO PE=3 SV=2 Back     alignment and function description
>sp|A2XRZ6|AKR3_ORYSI Probable aldo-keto reductase 3 OS=Oryza sativa subsp. indica GN=H0813E03.4 PE=3 SV=1 Back     alignment and function description
>sp|P63485|Y2320_MYCBO Uncharacterized oxidoreductase Mb2320 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2320 PE=3 SV=1 Back     alignment and function description
>sp|P63484|Y2298_MYCTU Uncharacterized oxidoreductase Rv2298/MT2355 OS=Mycobacterium tuberculosis GN=Rv2298 PE=3 SV=1 Back     alignment and function description
>sp|Q9P7U2|YI7E_SCHPO Putative aryl-alcohol dehydrogenase C977.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.14c PE=1 SV=1 Back     alignment and function description
>sp|Q3L181|PERR_RAUSE Perakine reductase OS=Rauvolfia serpentina GN=PR PE=1 SV=1 Back     alignment and function description
>sp|P80874|GS69_BACSU General stress protein 69 OS=Bacillus subtilis (strain 168) GN=yhdN PE=1 SV=2 Back     alignment and function description
>sp|C6TBN2|AKR1_SOYBN Probable aldo-keto reductase 1 OS=Glycine max GN=AKR1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
225446767367 PREDICTED: uncharacterized oxidoreductas 0.955 0.700 0.844 1e-124
224066531 372 predicted protein [Populus trichocarpa] 0.955 0.690 0.848 1e-123
224082608369 predicted protein [Populus trichocarpa] 0.951 0.693 0.848 1e-122
388498502367 unknown [Lotus japonicus] 0.955 0.700 0.797 1e-120
255561154369 aldo/keto reductase, putative [Ricinus c 0.955 0.696 0.806 1e-119
356567476368 PREDICTED: uncharacterized oxidoreductas 0.955 0.698 0.790 1e-118
255645632301 unknown [Glycine max] 0.955 0.853 0.790 1e-118
356526938368 PREDICTED: uncharacterized oxidoreductas 0.955 0.698 0.779 1e-117
224082610362 predicted protein [Populus trichocarpa] 0.951 0.707 0.774 1e-113
297848944 377 aldo/keto reductase family protein [Arab 0.881 0.628 0.806 1e-109
>gi|225446767|ref|XP_002278419.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic [Vitis vinifera] gi|302143505|emb|CBI22066.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 217/257 (84%), Positives = 233/257 (90%)

Query: 1   MAMHVSGACFSVFSGSRVGNIRAVASEGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGD 60
           MA++VS ACF  FS  RV  I+AVASEGFATVKT E+KVKLGGSDLKVTKLG+GAWSWGD
Sbjct: 1   MALYVSSACFCGFSQKRVERIKAVASEGFATVKTEEEKVKLGGSDLKVTKLGIGAWSWGD 60

Query: 61  TSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKER 120
           TSYWNNF+WDDRKMKAAK AFD S+D GIT FDTAEVYGSR SFGAINSETLLGRFIKER
Sbjct: 61  TSYWNNFEWDDRKMKAAKGAFDASIDVGITLFDTAEVYGSRFSFGAINSETLLGRFIKER 120

Query: 121 KQRDPEVEVTVATKFAALPWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFI 180
           K+++PEVEV VATKFAALPWR GRQSV+ ALKDSL RLGL SV+LYQLHW G+WGNEG+I
Sbjct: 121 KEKNPEVEVAVATKFAALPWRFGRQSVITALKDSLCRLGLLSVDLYQLHWPGVWGNEGYI 180

Query: 181 DGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKA 240
           DGLGDAVE GLVKAVGVSNYSEKRL  AYEKLKKRGIPLASNQVNYSL+YR PEENGVKA
Sbjct: 181 DGLGDAVEMGLVKAVGVSNYSEKRLLEAYEKLKKRGIPLASNQVNYSLLYRLPEENGVKA 240

Query: 241 ACDELGITLIAYCPIAQ 257
           ACDELG+TLIAY PIAQ
Sbjct: 241 ACDELGVTLIAYSPIAQ 257

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224066531|ref|XP_002302125.1| predicted protein [Populus trichocarpa] gi|222843851|gb|EEE81398.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224082608|ref|XP_002306762.1| predicted protein [Populus trichocarpa] gi|222856211|gb|EEE93758.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388498502|gb|AFK37317.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255561154|ref|XP_002521589.1| aldo/keto reductase, putative [Ricinus communis] gi|223539267|gb|EEF40860.1| aldo/keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356567476|ref|XP_003551945.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255645632|gb|ACU23310.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356526938|ref|XP_003532072.1| PREDICTED: uncharacterized oxidoreductase At1g06690, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224082610|ref|XP_002306763.1| predicted protein [Populus trichocarpa] gi|222856212|gb|EEE93759.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297848944|ref|XP_002892353.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297338195|gb|EFH68612.1| aldo/keto reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
TAIR|locus:2009120377 AT1G06690 "AT1G06690" [Arabido 0.881 0.628 0.806 6.9e-102
TAIR|locus:2168601365 PLR1 "AT5G53580" [Arabidopsis 0.780 0.575 0.433 3.4e-38
TIGR_CMR|DET_0217324 DET_0217 "oxidoreductase, aldo 0.754 0.626 0.351 1.4e-23
UNIPROTKB|P77735324 yajO [Escherichia coli K-12 (t 0.773 0.641 0.313 3.9e-21
TAIR|locus:2042124 384 AT2G27680 "AT2G27680" [Arabido 0.721 0.505 0.276 7.3e-17
UNIPROTKB|Q0C2F5 344 HNE_1371 "Dimethylsulfoxide re 0.750 0.587 0.328 2.1e-16
UNIPROTKB|P63484 323 MT2355 "Uncharacterized oxidor 0.702 0.585 0.345 3.2e-16
POMBASE|SPAC977.14c 351 SPAC977.14c "aldo/keto reducta 0.304 0.233 0.395 4.5e-14
UNIPROTKB|Q46851 346 yghZ [Escherichia coli K-12 (t 0.691 0.537 0.305 1.6e-13
UNIPROTKB|Q8X529 346 gpr "L-glyceraldehyde 3-phosph 0.691 0.537 0.305 4.7e-13
TAIR|locus:2009120 AT1G06690 "AT1G06690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1010 (360.6 bits), Expect = 6.9e-102, P = 6.9e-102
 Identities = 192/238 (80%), Positives = 213/238 (89%)

Query:    21 IRAVAS-EGFATVKTAEDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKA 79
             +RAVAS +  A   + E KVKLGGSDLKVTKLG+G WSWGD SYWN+FQWDDRK+KAAK 
Sbjct:    30 VRAVASGDSVAPAISEESKVKLGGSDLKVTKLGIGVWSWGDNSYWNDFQWDDRKLKAAKG 89

Query:    80 AFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALP 139
             AFDTSLDNGI FFDTAEVYGS+ S GAI+SETLLGRFI+ERK+R P  EV+VATKFAALP
Sbjct:    90 AFDTSLDNGIDFFDTAEVYGSKFSLGAISSETLLGRFIRERKERYPGAEVSVATKFAALP 149

Query:   140 WRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGIWGNEGFIDGLGDAVEQGLVKAVGVSN 199
             WR GR+SV+ ALKDSL RL LSSV+LYQLHW G+WGNEG++DGLGDAVEQGLVKAVGVSN
Sbjct:   150 WRFGRESVVTALKDSLSRLELSSVDLYQLHWPGLWGNEGYLDGLGDAVEQGLVKAVGVSN 209

Query:   200 YSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQ 257
             YSEKRLR+AYE+LKKRGIPLASNQVNYSLIYR PE+ GVKAACDELG+TLIAY PIAQ
Sbjct:   210 YSEKRLRDAYERLKKRGIPLASNQVNYSLIYRAPEQTGVKAACDELGVTLIAYSPIAQ 267
GO:0004033 "aldo-keto reductase (NADP) activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0010287 "plastoglobule" evidence=IDA
TAIR|locus:2168601 PLR1 "AT5G53580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0217 DET_0217 "oxidoreductase, aldo/keto reductase family" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|P77735 yajO [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TAIR|locus:2042124 AT2G27680 "AT2G27680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C2F5 HNE_1371 "Dimethylsulfoxide reductase chain B" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|P63484 MT2355 "Uncharacterized oxidoreductase Rv2298/MT2355" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
POMBASE|SPAC977.14c SPAC977.14c "aldo/keto reductase, unknown biological role" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|Q46851 yghZ [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q8X529 gpr "L-glyceraldehyde 3-phosphate reductase" [Escherichia coli O157:H7 (taxid:83334)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94A68Y1669_ARATH1, ., -, ., -, ., -0.80670.88100.6286yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 2e-58
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 9e-53
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 7e-47
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 2e-40
PRK09912 346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 7e-15
PRK10625346 PRK10625, tas, putative aldo-keto reductase; Provi 7e-14
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 2e-10
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 2e-10
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 1e-08
TIGR01293317 TIGR01293, Kv_beta, voltage-dependent potassium ch 2e-08
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 2e-07
PLN02587314 PLN02587, PLN02587, L-galactose dehydrogenase 1e-06
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 2e-04
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information 
 Score =  187 bits (477), Expect = 2e-58
 Identities = 85/225 (37%), Positives = 120/225 (53%), Gaps = 27/225 (12%)

Query: 38  KVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEV 97
              LG + LKV++LG+G W  G         + D +   A AA   +LD GI F DTA+V
Sbjct: 1   YRTLGKTGLKVSRLGLGTWQLGG-------GYVDEE--EAAAAVRAALDAGINFIDTADV 51

Query: 98  YGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPW---RLGRQSVLAALKDS 154
           Y      G   SE LLG  +KER  R+   EV +ATK    P     L  + +  A+++S
Sbjct: 52  Y------GDGESEELLGEALKERGPRE---EVFIATKVGPRPGDGRDLSPEHIRRAVEES 102

Query: 155 LFRLGLSSVELYQLHW--AGIWGNEGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAYEKL 212
           L RLG   ++LY LHW        E  +  L + V++G ++A+GVSN+S ++L  A   L
Sbjct: 103 LKRLGTDYIDLYLLHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEA---L 159

Query: 213 KKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQ 257
              G+P A NQV Y+L+ R+ EE  +   C E GI +IAY P+A 
Sbjct: 160 AAAGVPPAVNQVEYNLLDRQAEE-ELLPYCREHGIGVIAYSPLAG 203

AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575 336 consensus Voltage-gated shaker-like K+ channel, su 100.0
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
PRK09912 346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
PLN02587314 L-galactose dehydrogenase 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
PRK10376290 putative oxidoreductase; Provisional 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
PRK14863292 bifunctional regulator KidO; Provisional 100.0
COG4989298 Predicted oxidoreductase [General function predict 100.0
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 100.0
KOG1576342 consensus Predicted oxidoreductase [Energy product 100.0
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.3
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 94.43
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 93.39
PRK08392215 hypothetical protein; Provisional 93.08
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 91.96
PRK07945335 hypothetical protein; Provisional 91.4
PRK08609570 hypothetical protein; Provisional 91.15
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 90.69
PRK13796 365 GTPase YqeH; Provisional 90.58
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 89.86
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 89.58
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 87.55
PRK07328269 histidinol-phosphatase; Provisional 87.44
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 87.29
PRK06740331 histidinol-phosphatase; Validated 87.02
PRK05588255 histidinol-phosphatase; Provisional 86.66
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 86.28
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 86.17
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 84.44
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 84.21
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 84.07
PF00682237 HMGL-like: HMGL-like of this family is not conserv 83.54
PRK14461371 ribosomal RNA large subunit methyltransferase N; P 82.97
cd03174 265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 82.88
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 82.76
PRK00208250 thiG thiazole synthase; Reviewed 82.09
PLN02681455 proline dehydrogenase 82.05
cd03322361 rpsA The starvation sensing protein RpsA from E.co 81.54
PRK14464344 ribosomal RNA large subunit methyltransferase N; P 81.46
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 81.26
PRK07329246 hypothetical protein; Provisional 81.03
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 80.92
PRK14017382 galactonate dehydratase; Provisional 80.48
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-53  Score=382.99  Aligned_cols=210  Identities=37%  Similarity=0.585  Sum_probs=190.7

Q ss_pred             ceeeEeCCCCcccccceecccccCCCCcCCCCCCChhhHHHHHHHHHHHHHCCCCeeecccccCCCCCCCCCchHHHHHH
Q 024292           36 EDKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGR  115 (269)
Q Consensus        36 m~~~~lg~tg~~vs~lglG~~~~g~~~~~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DTA~~Yg~g~~~~~~~sE~~lG~  115 (269)
                      |++++||+||++||+||||||.||+.       +.+.+.+++.++|++|+|+||||||||+.||.|.+      |++||+
T Consensus         1 m~~r~lG~~gl~vs~lglG~~~~g~~-------~~~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~g~s------E~ilG~   67 (316)
T COG0667           1 MKYRRLGRSGLKVSPLGLGTMTLGGD-------TDDEEEAEAIEILDAALDAGINFFDTADVYGDGRS------EEILGE   67 (316)
T ss_pred             CCceecCCCCceecceeeeccccCCC-------CCchhhhHHHHHHHHHHHcCCCEEECccccCCCch------HHHHHH
Confidence            78999999999999999999999874       22344568888999999999999999999999987      999999


Q ss_pred             HHhhccCCCCCCcEEEEecCCCCC--------CCCCHHHHHHHHHHHHHHhCCCccceEEeecCCC-CChHHHHHHHHHH
Q 024292          116 FIKERKQRDPEVEVTVATKFAALP--------WRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLGDA  186 (269)
Q Consensus       116 al~~~~~~~~R~~v~I~tK~~~~~--------~~~~~~~i~~~l~~sL~~L~~dyiDl~~lH~p~~-~~~~~~~~~L~~l  186 (269)
                      ||+.++.   |++++|+||++..+        .+.++++|+++++.||+|||||||||||+||||+ .+.++++++|.+|
T Consensus        68 ~l~~~~~---Rd~vvIaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l  144 (316)
T COG0667          68 ALKERGR---RDKVVIATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDEL  144 (316)
T ss_pred             HHhccCC---CCeEEEEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHH
Confidence            9999863   79999999998743        3468999999999999999999999999999998 7789999999999


Q ss_pred             HHcCCccEEEecCcCHHHHHHHHHHHHhcCCCeeEEcccCCccCCCcchhhHHHHHHHcCCeEEEcccccCCcchhhhcc
Q 024292          187 VEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAARL  266 (269)
Q Consensus       187 ~~~G~ir~iGvSn~~~~~l~~~~~~~~~~~~~~~~~Q~~~s~~~~~~~~~~l~~~~~~~gi~via~~pl~~G~l~~~~~~  266 (269)
                      +++||||+||+||++++++.++.+.+    .+++++|.+||+++|+.+. +++++|+++||++++|+||++|+  |++|+
T Consensus       145 ~~~G~ir~iG~S~~~~~~i~~a~~~~----~~~~~~Q~~ynl~~R~~e~-~l~~~~~~~gi~~~~~spla~G~--Ltgk~  217 (316)
T COG0667         145 VREGKIRYIGVSNYSAEQIAEALAVA----APIDSLQPEYNLLERDAEK-ELLPLCREEGIGLLAYSPLASGL--LTGKY  217 (316)
T ss_pred             HHcCCeeEEEecCCCHHHHHHHHHhc----CCceeecccCccccccchh-HHHHHHHHcCCeEEEecCccccc--cCCCc
Confidence            99999999999999999999998874    4799999999999987765 49999999999999999999999  88876


Q ss_pred             cc
Q 024292          267 KT  268 (269)
Q Consensus       267 ~~  268 (269)
                      ..
T Consensus       218 ~~  219 (316)
T COG0667         218 LP  219 (316)
T ss_pred             CC
Confidence            53

>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK07328 histidinol-phosphatase; Provisional Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>PRK06740 histidinol-phosphatase; Validated Back     alignment and domain information
>PRK05588 histidinol-phosphatase; Provisional Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PLN02681 proline dehydrogenase Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>PRK07329 hypothetical protein; Provisional Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
3uyi_A 337 Crystal Structure Of Perakine Reductase, Founder Me 1e-15
3v0u_A 338 Crystal Structure Of Perakine Reductase, Founder Me 2e-15
3v0t_A 337 Crystal Structure Of Perakine Reductase, Founder Me 2e-15
1pz1_A 333 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 7e-15
3v0s_A 337 Crystal Structure Of Perakine Reductase, Founder Me 2e-14
4aub_A 366 The Complex Structure Of The Bacterial Aldo-Keto Re 4e-14
3n6q_A 346 Crystal Structure Of Yghz From E. Coli Length = 346 5e-14
3erp_A353 Structure Of Idp01002, A Putative Oxidoreductase Fr 1e-12
1ynp_A317 Aldo-keto Reductase Akr11c1 From Bacillus Haloduran 2e-12
3n2t_A 348 Structure Of The Glycerol Dehydrogenase Akr11b4 Fro 2e-11
1pyf_A312 Structure Of Nadph-Dependent Family 11 Aldo-Keto Re 5e-11
3eb3_A 327 Voltage-Dependent K+ Channel Beta Subunit (W121a) I 3e-10
2a79_A 333 Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu 3e-10
3eau_A 327 Voltage-Dependent K+ Channel Beta Subunit In Comple 4e-10
1exb_A 332 Structure Of The Cytoplasmic Beta Subunit-T1 Assemb 4e-10
1qrq_A325 Structure Of A Voltage-Dependent K+ Channel Beta Su 4e-10
3lut_A 367 A Structural Model For The Full-Length Shaker Potas 4e-10
3eb4_A 327 Voltage-Dependent K+ Channel Beta Subunit (I211r) I 4e-10
1zsx_A347 Crystal Structure Of Human Potassium Channel Kv Bet 7e-10
1lqa_A346 Tas Protein From Escherichia Coli In Complex With N 1e-09
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 8e-09
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 2e-08
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 1e-07
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 4e-07
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 1e-06
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 2e-06
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 2e-06
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 2e-06
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 7e-06
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 9e-06
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 9e-06
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 1e-05
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 1e-05
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 2e-05
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 3e-05
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 3e-05
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 4e-05
2alr_A324 Aldehyde Reductase Length = 324 8e-05
1a80_A277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 1e-04
1m9h_A278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 1e-04
1hw6_A278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 1e-04
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 2e-04
3f7j_A276 B.Subtilis Yvgn Length = 276 2e-04
3cv6_A323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 3e-04
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 4e-04
3fjn_A323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 4e-04
2he5_A323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 4e-04
2ipg_A319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 4e-04
2ipf_A318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 4e-04
3o3r_A316 Crystal Structure Of Akr1b14 In Complex With Nadp L 5e-04
3qkz_A316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 5e-04
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 6e-04
>pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 113/228 (49%), Gaps = 29/228 (12%)
Query: 38  KVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEV 97
           +VKLG   L+V+KLG G    G +  +N+   +++ +   K AF+     GITFFDT+++
Sbjct: 4   RVKLGTQGLEVSKLGFGCM--GLSGDYNDALPEEQGIAVIKEAFNC----GITFFDTSDI 57
Query: 98  YGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATK-------FAALPWRLGRQSVLAA 150
           YG   S     +E LLG+ +K+     P  ++ V TK       F+ +  +     V + 
Sbjct: 58  YGENGS-----NEELLGKALKQL----PREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSC 108
Query: 151 LKDSLFRLGLSSVELYQLHWAGIWGN-EGFIDGLGDAVEQGLVKAVGVSNYSEKRLRNAY 209
            + SL RL +  ++L+ +H        E  +  L   VE+G +K VG+S  S   +R A+
Sbjct: 109 CEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELXKLVEEGKIKYVGLSEASPDTIRRAH 168
Query: 210 EKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQ 257
                   P+ + Q+ YSL  R  E+  +   C +LGI ++ Y PI +
Sbjct: 169 AVH-----PVTALQIEYSLWTRDIEDE-IVPLCRQLGIGIVPYSPIGR 210
>pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 Back     alignment and structure
>pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 Back     alignment and structure
>pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 Back     alignment and structure
>pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 Back     alignment and structure
>pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 Back     alignment and structure
>pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 Back     alignment and structure
>pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 Back     alignment and structure
>pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 Back     alignment and structure
>pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 Back     alignment and structure
>pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 Back     alignment and structure
>pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 Back     alignment and structure
>pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 Back     alignment and structure
>pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 Back     alignment and structure
>pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 Back     alignment and structure
>pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 Back     alignment and structure
>pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 6e-49
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 4e-47
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 5e-45
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 3e-44
3erp_A353 Putative oxidoreductase; funded by the national in 7e-43
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 2e-42
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 9e-40
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 2e-39
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 6e-39
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 7e-39
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 1e-34
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 4e-33
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 6e-26
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 1e-21
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 4e-19
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 1e-18
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 1e-18
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-18
4gie_A290 Prostaglandin F synthase; structural genomics, nia 2e-18
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 4e-18
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 5e-18
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 2e-17
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 6e-17
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 6e-17
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 1e-16
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 1e-16
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 1e-15
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 1e-15
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 5e-15
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 6e-14
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 7e-13
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 1e-12
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 1e-12
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 2e-12
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 4e-12
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 6e-12
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 2e-11
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 8e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
 Score =  163 bits (415), Expect = 6e-49
 Identities = 65/239 (27%), Positives = 113/239 (47%), Gaps = 50/239 (20%)

Query: 37  DKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAE 96
           +   +  + ++ +++G+G W+ G T +      D+   K +      +LD GIT  DTA 
Sbjct: 2   EYTSIADTGIEASRIGLGTWAIGGTMWGGT---DE---KTSIETIRAALDQGITLIDTAP 55

Query: 97  VYGSRASFGAINSETLLGRFIKERKQRDPEVEVTVATKFAALPWR-------LGRQSVLA 149
            YG    FG   SE ++G+ IKE  +RD   +V +ATK  AL W+         R  ++ 
Sbjct: 56  AYG----FGQ--SEEIVGKAIKEYMKRD---QVILATKT-ALDWKNNQLFRHANRARIVE 105

Query: 150 ALKDSLFRLGLSSVELYQLHWAGIWGNEGFID----------GLGDAVEQGLVKAVGVSN 199
            +++SL RL    ++LYQ+HW          D           + +  + G ++A+GVSN
Sbjct: 106 EVENSLKRLQTDYIDLYQVHW---------PDPLVPIEETAEVMKELYDAGKIRAIGVSN 156

Query: 200 YSEKRLRNAYEKLKKRGI-PLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQ 257
           +S +++         R + PL + Q  Y+L  R+ EE+ V     +  IT + Y  + +
Sbjct: 157 FSIEQMDTF------RAVAPLHTIQPPYNLFEREMEES-VLPYAKDNKITTLLYGSLCR 208
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 100.0
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 100.0
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 98.06
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 94.64
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 93.92
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 93.83
2qgy_A391 Enolase from the environmental genome shotgun sequ 93.6
2o56_A407 Putative mandelate racemase; dehydratase, structur 93.53
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 93.3
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 93.22
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 93.21
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 93.08
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 92.88
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 92.79
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 92.72
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 92.63
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 92.61
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 92.5
2gl5_A410 Putative dehydratase protein; structural genomics, 92.45
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 92.37
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 92.26
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 92.25
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 92.21
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 91.88
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 91.82
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 91.78
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 91.77
2poz_A392 Putative dehydratase; octamer, structural genomics 91.68
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 91.09
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 90.61
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 90.28
3rr1_A 405 GALD, putative D-galactonate dehydratase; enolase, 90.21
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 90.07
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 89.88
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 89.69
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 89.18
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 89.12
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 89.07
3r0u_A379 Enzyme of enolase superfamily; structural genomics 88.94
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 88.93
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 88.88
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 88.79
1tzz_A392 Hypothetical protein L1841; structural genomics, m 88.68
3eez_A378 Putative mandelate racemase/muconate lactonizing e 88.51
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 88.11
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 87.92
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 87.88
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 87.8
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 87.69
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 87.27
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 85.95
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 85.9
2oz8_A389 MLL7089 protein; structural genomics, unknown func 85.82
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 85.61
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 85.41
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 84.91
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 84.86
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 84.54
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 84.33
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 84.31
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 84.27
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 83.92
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 83.74
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 83.65
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 83.47
3rcy_A 433 Mandelate racemase/muconate lactonizing enzyme-LI 83.31
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 83.24
3lmz_A 257 Putative sugar isomerase; structural genomics, joi 83.12
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 82.38
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 82.33
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 81.93
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 81.83
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 80.82
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 80.33
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
Probab=100.00  E-value=8.6e-54  Score=388.98  Aligned_cols=213  Identities=30%  Similarity=0.466  Sum_probs=188.5

Q ss_pred             cceeeEeCCCCcccccceecccc-cCCCCcCCCCCCChhhHHHHHHHHHHHHHCCCCeeecccccCC--CCCCCCCchHH
Q 024292           35 AEDKVKLGGSDLKVTKLGVGAWS-WGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGS--RASFGAINSET  111 (269)
Q Consensus        35 ~m~~~~lg~tg~~vs~lglG~~~-~g~~~~~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DTA~~Yg~--g~~~~~~~sE~  111 (269)
                      .|+||+||+||++||+||||||. +|..          .+.+++.++|+.|++.||||||||+.||+  |.|      |+
T Consensus        12 ~M~~r~lg~tg~~vs~lglGt~~~~g~~----------~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~~~G~s------E~   75 (346)
T 3n6q_A           12 QMQYRYCGKSGLRLPALSLGLWHNFGHV----------NALESQRAILRKAFDLGITHFDLANNYGPPPGSA------EE   75 (346)
T ss_dssp             SCCEEECTTSSCEEESEEEECSSSCSTT----------SCHHHHHHHHHHHHHTTCCEEECCTTCTTTTTHH------HH
T ss_pred             CceeEecCCCCCeecCeeecCccccCCC----------CCHHHHHHHHHHHHHcCCCEEECccccCCCCCcH------HH
Confidence            69999999999999999999985 3322          45689999999999999999999999998  766      99


Q ss_pred             HHHHHHhhccCCCCCCcEEEEecCCCCCC------CCCHHHHHHHHHHHHHHhCCCccceEEeecCCC-CChHHHHHHHH
Q 024292          112 LLGRFIKERKQRDPEVEVTVATKFAALPW------RLGRQSVLAALKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLG  184 (269)
Q Consensus       112 ~lG~al~~~~~~~~R~~v~I~tK~~~~~~------~~~~~~i~~~l~~sL~~L~~dyiDl~~lH~p~~-~~~~~~~~~L~  184 (269)
                      .+|++|++.... .|+++||+||++...+      ..+++.+++++++||+|||+||||||++|||++ .+.+++|++|+
T Consensus        76 ~lG~al~~~~~~-~R~~~~I~TK~g~~~~~~~~~~~~s~~~i~~~~e~SL~rL~~dyiDl~~lH~p~~~~~~~e~~~al~  154 (346)
T 3n6q_A           76 NFGRLLREDFAA-YRDELIISTKAGYDMWPGPYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHRVDENTPMEETASALA  154 (346)
T ss_dssp             HHHHHHHHHCTT-TGGGCEEEEEECSCCSSSTTSSSSCHHHHHHHHHHHHHHHTCSCEEEEEECSCCTTSCHHHHHHHHH
T ss_pred             HHHHHHHhhccc-ccccEEEEEEecccCCCCCCCCCCCHHHHHHHHHHHHHHhCCCcEeEEEEeCCCCCCCHHHHHHHHH
Confidence            999999984321 2899999999864211      238999999999999999999999999999987 56899999999


Q ss_pred             HHHHcCCccEEEecCcCHHHHHHHHHHHHhcCCCeeEEcccCCccCCCcchhhHHHHHHHcCCeEEEcccccCCcchhhh
Q 024292          185 DAVEQGLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAA  264 (269)
Q Consensus       185 ~l~~~G~ir~iGvSn~~~~~l~~~~~~~~~~~~~~~~~Q~~~s~~~~~~~~~~l~~~~~~~gi~via~~pl~~G~l~~~~  264 (269)
                      +|+++||||+||||||++++++++.+.++..+.+++++|++||++++..+..+++++|+++||++++|+||++|+  |++
T Consensus       155 ~l~~~Gkir~iGvSn~~~~~l~~~~~~~~~~~~~~~~~Q~~~~l~~~~~~~~~l~~~~~~~gi~v~a~spL~~G~--L~g  232 (346)
T 3n6q_A          155 HAVQSGKALYVGISSYSPERTQKMVELLREWKIPLLIHQPSYNLLNRWVDKSGLLDTLQNNGVGCIAFTPLAQGL--LTG  232 (346)
T ss_dssp             HHHHTTSEEEEEEESCCHHHHHHHHHHHHTTTCCCCEEECBCBTTBCHHHHTTHHHHHHHHTCEEEEBSTTGGGG--GGT
T ss_pred             HHHHcCCeeEEEeCCCCHHHHHHHHHHHHHcCCCeEEEeccCchhhcCcchhhHHHHHHHcCCeEEEeccccCee--cCC
Confidence            999999999999999999999999998887778899999999999998765469999999999999999999998  555


Q ss_pred             cc
Q 024292          265 RL  266 (269)
Q Consensus       265 ~~  266 (269)
                      ++
T Consensus       233 ~~  234 (346)
T 3n6q_A          233 KY  234 (346)
T ss_dssp             SC
T ss_pred             Cc
Confidence            53
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 5e-33
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 4e-25
d3eaua1 326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 3e-23
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 3e-19
d1pz1a_ 333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 1e-18
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 4e-18
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 4e-17
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 4e-17
d1gvea_ 324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 5e-15
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 7e-15
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 8e-15
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-14
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-14
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 7e-14
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 1e-12
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-11
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Tas protein
species: Escherichia coli [TaxId: 562]

 Score =  121 bits (303), Expect = 5e-33
 Identities = 56/247 (22%), Positives = 97/247 (39%), Gaps = 38/247 (15%)

Query: 38  KVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEV 97
             ++  S L+V+ LG+G  ++G+       Q  +     A A  D ++  GI   D AE+
Sbjct: 3   YHRIPHSSLEVSTLGLGTMTFGE-------QNSE---ADAHAQLDYAVAQGINLIDVAEM 52

Query: 98  YGS-RASFGAINSETLLGRFIKERKQRDPEVEVTVA-------TKFAALPWRLGRQSVLA 149
           Y           +ET +G ++ +   R+  +  +          K       L R+++  
Sbjct: 53  YPVPPRPETQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIRE 112

Query: 150 ALKDSLFRLGLSSVELYQLHWAG------------------IWGNEGFIDGLGDAVEQGL 191
           AL DSL RL    ++LYQ+HW                           +D L +    G 
Sbjct: 113 ALHDSLKRLQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGK 172

Query: 192 VKAVGVSNYSEKRLRNAYEKLKKRGIP-LASNQVNYSLIYRKPEENGVKAACDELGITLI 250
           ++ +GVSN +   +        K  +P + + Q  YSL+ R  E  G+       G+ L+
Sbjct: 173 IRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEV-GLAEVSQYEGVELL 231

Query: 251 AYCPIAQ 257
           AY  +  
Sbjct: 232 AYSCLGF 238
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 100.0
d1gvea_ 324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 100.0
d1pz1a_ 333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d3eaua1 326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 92.62
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 92.3
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 92.15
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 92.03
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 90.95
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 90.85
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 89.35
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 86.51
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 86.04
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 84.82
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 83.44
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 82.27
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 81.64
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 81.54
d2q02a1 271 Putative cytoplasmic protein STM4435 {Salmonella t 81.47
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Putative oxidoreductase IolS
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=9e-49  Score=348.11  Aligned_cols=207  Identities=27%  Similarity=0.445  Sum_probs=186.2

Q ss_pred             eeeEeCCCCcccccceecccccCCCCcCCCCCCChhhHHHHHHHHHHHHHCCCCeeecccccCCCCCCCCCchHHHHHHH
Q 024292           37 DKVKLGGSDLKVTKLGVGAWSWGDTSYWNNFQWDDRKMKAAKAAFDTSLDNGITFFDTAEVYGSRASFGAINSETLLGRF  116 (269)
Q Consensus        37 ~~~~lg~tg~~vs~lglG~~~~g~~~~~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DTA~~Yg~g~~~~~~~sE~~lG~a  116 (269)
                      ++|+||+||++||+||||||++|....|     ...+++++.++|++|+++|||+||||+.||+|.+      |+.+|++
T Consensus         1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~-----~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~g~s------E~~lg~~   69 (311)
T d1pyfa_           1 KKAKLGKSDLQVFPIGLGTNAVGGHNLY-----PNLNEETGKELVREAIRNGVTMLDTAYIYGIGRS------EELIGEV   69 (311)
T ss_dssp             CCEECTTSCCEECSBCEECTTSSCTTTC-----SSCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHH------HHHHHHH
T ss_pred             CCcccCCCCCeecceeeeCcccCCCCCC-----CCCCHHHHHHHHHHHHHcCCCEEEehhhcCCCcc------HHHHhhh
Confidence            5899999999999999999999876433     3457789999999999999999999999999876      9999999


Q ss_pred             HhhccCCCCCCcEEEEecCCCC------CCCCCHHHHHHHHHHHHHHhCCCccceEEeecCCC-CChHHHHHHHHHHHHc
Q 024292          117 IKERKQRDPEVEVTVATKFAAL------PWRLGRQSVLAALKDSLFRLGLSSVELYQLHWAGI-WGNEGFIDGLGDAVEQ  189 (269)
Q Consensus       117 l~~~~~~~~R~~v~I~tK~~~~------~~~~~~~~i~~~l~~sL~~L~~dyiDl~~lH~p~~-~~~~~~~~~L~~l~~~  189 (269)
                      |+..+    |++++|+||++..      ..+.+++.+++++++||+||++||||+|++|+|+. .+.++++++|++|+++
T Consensus        70 l~~~~----r~~~~i~tK~~~~~~~~~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~  145 (311)
T d1pyfa_          70 LREFN----REDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKA  145 (311)
T ss_dssp             HTTSC----GGGCEEEEEECEEEETTEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHT
T ss_pred             hhccc----ccceecceeccCCCCCcccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhC
Confidence            98765    8999999999752      24578999999999999999999999999999987 6789999999999999


Q ss_pred             CCccEEEecCcCHHHHHHHHHHHHhcCCCeeEEcccCCccCCCcchhhHHHHHHHcCCeEEEcccccCCcchhhhcc
Q 024292          190 GLVKAVGVSNYSEKRLRNAYEKLKKRGIPLASNQVNYSLIYRKPEENGVKAACDELGITLIAYCPIAQDSPIFAARL  266 (269)
Q Consensus       190 G~ir~iGvSn~~~~~l~~~~~~~~~~~~~~~~~Q~~~s~~~~~~~~~~l~~~~~~~gi~via~~pl~~G~l~~~~~~  266 (269)
                      ||||+||||||+++.+.++.+.     .+++++|++||++++..+. +++++|+++||++++|+|+++|+  +++++
T Consensus       146 Gkir~iGvs~~~~~~~~~~~~~-----~~~~~~q~~~n~~~~~~~~-~~~~~~~~~~i~v~~~~~l~~G~--l~~~~  214 (311)
T d1pyfa_         146 GKIRSIGVSNFSLEQLKEANKD-----GLVDVLQGEYNLLNREAEK-TFFPYTKEHNISFIPYFPLVSGL--LAGKY  214 (311)
T ss_dssp             TSBSCEEEESCCHHHHHHHTTT-----SCCCEEEEECBTTBCGGGT-THHHHHHHHTCEEEEESTTTTTG--GGTCC
T ss_pred             CeEEeecccCCcHHHHHHHhhc-----CCcceEeeeecccchhhhH-HHHHHHHHCCceEEEeccccCCc--cCCCc
Confidence            9999999999999999888654     5799999999999988765 69999999999999999999999  55544
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure