Citrus Sinensis ID: 024293


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MKNQEHEEERKRRENHINEQVEAETMAASAATDGVAATALRSVIQRVHQAAERSSRPPDRIRIVAVSKTKPVSVIRQVYEAGHRCFGENYVQEIVEKAAQLPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGRKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGMPDYTSTPENFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKN
cccHHHHHHHHHcccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccEEEEccHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEcccccccHHHHHHccccEEEEcccccccccccccc
**************************************ALRSVIQRVHQAAERSSRPPDRIRIVAVSKTKPVSVIRQVYEAGHRCFGENYVQEIVEKAAQLPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGRKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGMPDYTSTPENFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFG*RE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKxxxxxxxxxxxxxxxxxxxxxETMAASAATDGVAATALRSVIQRVHQAAERSSRPPDRIRIVAVSKTKPVSVIRQVYEAGHRCFGENYVQEIVEKAAQLPDDLEWHFIGNLQSNKVKPLLAGVPNLAMVESVDNEKIAGRLNRMVETMGRKPLKVLVQVNTSGEESKSGVEPSGCLELVKHVSQNCPNLEFCGLMTIGMPDYTSTPENFKTLAKCRSEVCKALGIPEEQCDLSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proline synthase co-transcribed bacterial homolog protein probableO94903
Proline synthase co-transcribed bacterial homolog protein probableQ9Z2Y8
Proline synthase co-transcribed bacterial homolog protein probableQ3T0G5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CT5, chain A
Confidence level:very confident
Coverage over the Query: 35-261
View the alignment between query and template
View the model in PyMOL