Citrus Sinensis ID: 024303


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MATRSSISLSLSFFLAFLCYLELCSCFYPKHLNLSAVGTHWSTAGATWYGSPDGAGSDGGACGYGNAVSQSPFSSFVTAIGPSLYKSGKECGACYQVKCTRHPACSGKAVRVVITDFCPGGPCVSESAHFDLSGTAFGAMAIPGQEEKLRDAGVLEVRYARVACDYSGRNIAFHVDQGSNPNYLAVVVEFEDGDGDLAGVDVKEGSGEWRAMQQSWGATWKLNAGSELHPPLSLRLTSQYSGQTLVANNVIPQGWMPGATYRSLVNYNV
ccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccCEEEEEEcccccccccccccccccccccccccccCEEECcccccccccccccEEEEEEccccccccccEEEEEECcccccccccccccccccHHHHHHcccccccHHHccccEEEEEEEEEECccccccEEEEEECcccccEEEEEEEECcccccEEEEEEEcccccEEEcccccccCEECcccccccccEEEEEEECcccCEEEEccccccccccccEEEccccEEc
*******SLSLSFFLAFLCYLELCSCFYPKHLNLSAVGTHWSTAGATWYGSPDGAGSDGGACGYGNAVSQSPFSSFVTAIGPSLYKSGKECGACYQVKCTRHPACSGKAVRVVITDFCPGGPCVSESAHFDLSGTAFGAMAIPGQEEKLRDAGVLEVRYARVACDYSGRNIAFHVDQGSNPNYLAVVVEFEDGDGDLAGVDVKEGSGEWRAMQQSWGATWKLNAGSELHPPLSLRLTSQYSGQTLVANNVIPQGWMPGATYRSLVNYN*
xxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATRSSISLSLSFFLAFLCYLELCSCFYPKHLNLSAVGTHWSTAGATWYGSPDGAGSDGGACGYGNAVSQSPFSSFVTAIGPSLYKSGKECGACYQVKCTRHPACSGKAVRVVITDFCPGGPCVSESAHFDLSGTAFGAMAIPGQEEKLRDAGVLEVRYARVACDYSGRNIAFHVDQGSNPNYLAVVVEFEDGDGDLAGVDVKEGSGEWRAMQQSWGATWKLNAGSELHPPLSLRLTSQYSGQTLVANNVIPQGWMPGATYRSLVNYNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Expansin-B18 May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence.probableQ5W6Z9
Expansin-B15 May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence.probableQ7XT40
Putative expansin-B2 May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found.probableQ9SHY6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HCZ, chain X
Confidence level:very confident
Coverage over the Query: 36-267
View the alignment between query and template
View the model in PyMOL