Citrus Sinensis ID: 024359
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 268 | ||||||
| 357516491 | 375 | hypothetical protein MTR_8g061040 [Medic | 0.917 | 0.656 | 0.723 | 1e-111 | |
| 356514643 | 383 | PREDICTED: uncharacterized protein LOC10 | 0.917 | 0.642 | 0.741 | 1e-111 | |
| 224114579 | 290 | predicted protein [Populus trichocarpa] | 0.955 | 0.882 | 0.730 | 1e-109 | |
| 224061280 | 286 | predicted protein [Populus trichocarpa] | 0.940 | 0.881 | 0.75 | 1e-109 | |
| 255554650 | 401 | DNA binding protein, putative [Ricinus c | 0.940 | 0.628 | 0.734 | 1e-107 | |
| 302142941 | 419 | unnamed protein product [Vitis vinifera] | 0.966 | 0.618 | 0.716 | 1e-106 | |
| 297834744 | 349 | sequence-specific DNA binding protein [A | 0.966 | 0.742 | 0.708 | 1e-105 | |
| 334185436 | 346 | sequence-specific DNA binding transcript | 0.955 | 0.739 | 0.704 | 1e-105 | |
| 42572475 | 349 | sequence-specific DNA binding transcript | 0.958 | 0.736 | 0.699 | 1e-104 | |
| 22331151 | 348 | sequence-specific DNA binding transcript | 0.958 | 0.738 | 0.699 | 1e-104 |
| >gi|357516491|ref|XP_003628534.1| hypothetical protein MTR_8g061040 [Medicago truncatula] gi|355522556|gb|AET03010.1| hypothetical protein MTR_8g061040 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 407 bits (1047), Expect = e-111, Method: Compositional matrix adjust.
Identities = 188/260 (72%), Positives = 218/260 (83%), Gaps = 14/260 (5%)
Query: 1 MGRPPSNGGPAFRFNPAEVTEMEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQM 60
MGRPPSNGGPAFRF EVTEME IL EH+NAMP+R++L ALA+KFSESP+RKGKI VQM
Sbjct: 1 MGRPPSNGGPAFRFTQPEVTEMEAILSEHNNAMPARDVLQALADKFSESPDRKGKITVQM 60
Query: 61 KQVWNWFQNRRYAIRAKSIKSPGKLNVTPLARDDSTPGRNVPQPVAAPIPIPMSASVPPT 120
KQVWNWFQN+RYAIRAKS K+P KLN+TP+ R D TPGR + QP A+PIP P +
Sbjct: 61 KQVWNWFQNKRYAIRAKSSKTPAKLNITPMPRTDLTPGRIMTQPTASPIPAPSA------ 114
Query: 121 MPASANVPSVSTAGRAASESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQVRFAG 180
SV T +AA E++ MEFEAKS RDGAWYDV+ FL+ R+ +++DPEV VRFAG
Sbjct: 115 --------SVQTTAKAAPENSVMEFEAKSGRDGAWYDVATFLSYRHLESSDPEVLVRFAG 166
Query: 181 FGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDAQRRR 240
FG+EEDEW+N++++VR RSLPCE+SECVAVLPGDLILCFQEGK+QALYFDAHVLDAQRRR
Sbjct: 167 FGSEEDEWINVRKNVRPRSLPCESSECVAVLPGDLILCFQEGKEQALYFDAHVLDAQRRR 226
Query: 241 HDVRGCRCRFLVRYDHDQSE 260
HDVRGCRCRFLVRYDHDQSE
Sbjct: 227 HDVRGCRCRFLVRYDHDQSE 246
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356514643|ref|XP_003526014.1| PREDICTED: uncharacterized protein LOC100783895 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224114579|ref|XP_002316800.1| predicted protein [Populus trichocarpa] gi|222859865|gb|EEE97412.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224061280|ref|XP_002300405.1| predicted protein [Populus trichocarpa] gi|222847663|gb|EEE85210.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255554650|ref|XP_002518363.1| DNA binding protein, putative [Ricinus communis] gi|223542458|gb|EEF43999.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|302142941|emb|CBI20236.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297834744|ref|XP_002885254.1| sequence-specific DNA binding protein [Arabidopsis lyrata subsp. lyrata] gi|297331094|gb|EFH61513.1| sequence-specific DNA binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|334185436|ref|NP_001189923.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] gi|332642569|gb|AEE76090.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42572475|ref|NP_974333.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] gi|332642568|gb|AEE76089.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22331151|ref|NP_188467.2| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] gi|20260286|gb|AAM13041.1| unknown protein [Arabidopsis thaliana] gi|28059773|gb|AAO30091.1| unknown protein [Arabidopsis thaliana] gi|332642567|gb|AEE76088.1| sequence-specific DNA binding transcription factor [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 268 | ||||||
| TAIR|locus:2095077 | 349 | SHH2 "SAWADEE homeodomain homo | 0.955 | 0.733 | 0.640 | 4.9e-85 | |
| TAIR|locus:1005716727 | 258 | SHH1 "AT1G15215" [Arabidopsis | 0.858 | 0.891 | 0.391 | 4.6e-34 |
| TAIR|locus:2095077 SHH2 "SAWADEE homeodomain homolog 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 851 (304.6 bits), Expect = 4.9e-85, P = 4.9e-85
Identities = 169/264 (64%), Positives = 196/264 (74%)
Query: 1 MGRPPSNGGPAFRFNPAEVTEMEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQM 60
MGRPPSNGGPAFRF EVTEME IL +H+ AMP R IL ALA+KFSESPERKGK++VQ
Sbjct: 1 MGRPPSNGGPAFRFILPEVTEMEAILLQHNTAMPGRHILEALADKFSESPERKGKVVVQF 60
Query: 61 KQVWNWFQNRRYAIRAKSIKSPGKLNVTPLARDDSTPG--RNXXXXXXXXXXXXMSASVP 118
KQ+WNWFQNRRYA+RA+ K+PGKLNV+ + R D P R+ M+ ++P
Sbjct: 61 KQIWNWFQNRRYALRARGNKAPGKLNVSSMPRMD-LPNQMRSVIQPLSVPKTTHMTGNLP 119
Query: 119 PTMPASAN--VPSVSTAGRAASESTFMEFEAKSARDGAWYDVSAFLAQRNFDTADPEVQV 176
PA + VP V +G S+++++EFEAKSARDGAWYDV AFLA RN + DPEVQV
Sbjct: 120 GMTPAPSGSLVPGVMRSG---SDNSYLEFEAKSARDGAWYDVQAFLAHRNLEIGDPEVQV 176
Query: 177 RFAGFGAEEDEWVNIKRHVRQRSLPCEASECVAVLPGDLILCFQEGKDQALYFDAHVLDA 236
RFAGF EEDEW+N+K+HVRQRSLPCEASECVAVL GDL+LCFQEGKDQALYFDA VLDA
Sbjct: 177 RFAGFEVEEDEWINVKKHVRQRSLPCEASECVAVLAGDLVLCFQEGKDQALYFDAIVLDA 236
Query: 237 QXXXXXXXXXXXXFLVRYDHDQSE 260
Q FLVRY HDQSE
Sbjct: 237 QRRRHDVRGCRCRFLVRYSHDQSE 260
|
|
| TAIR|locus:1005716727 SHH1 "AT1G15215" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 268 | |||
| smart00389 | 57 | smart00389, HOX, Homeodomain | 1e-05 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 2e-05 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 7e-04 |
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
Score = 41.9 bits (99), Expect = 1e-05
Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 12/63 (19%)
Query: 13 RFNPAEVTEMEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRY 72
F P ++ E+E Q++ PSRE LA+K S +QV WFQNRR
Sbjct: 7 SFTPEQLEELEKEFQKNPY--PSREEREELAKKLGLSE----------RQVKVWFQNRRA 54
Query: 73 AIR 75
+
Sbjct: 55 KWK 57
|
DNA-binding factors that are involved in the transcriptional regulation of key developmental processes. Length = 57 |
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| KOG0489 | 261 | consensus Transcription factor zerknullt and relat | 99.79 | |
| KOG0842 | 307 | consensus Transcription factor tinman/NKX2-3, cont | 99.78 | |
| KOG0488 | 309 | consensus Transcription factor BarH and related HO | 99.76 | |
| KOG0487 | 308 | consensus Transcription factor Abd-B, contains HOX | 99.69 | |
| KOG0843 | 197 | consensus Transcription factor EMX1 and related HO | 99.65 | |
| KOG0492 | 246 | consensus Transcription factor MSH, contains HOX d | 99.65 | |
| KOG0485 | 268 | consensus Transcription factor NKX-5.1/HMX1, conta | 99.61 | |
| KOG0850 | 245 | consensus Transcription factor DLX and related pro | 99.6 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.59 | |
| KOG0484 | 125 | consensus Transcription factor PHOX2/ARIX, contain | 99.55 | |
| KOG0493 | 342 | consensus Transcription factor Engrailed, contains | 99.5 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.48 | |
| KOG0491 | 194 | consensus Transcription factor BSH, contains HOX d | 99.45 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.44 | |
| KOG2251 | 228 | consensus Homeobox transcription factor [Transcrip | 99.44 | |
| KOG0494 | 332 | consensus Transcription factor CHX10 and related H | 99.39 | |
| KOG0848 | 317 | consensus Transcription factor Caudal, contains HO | 99.38 | |
| KOG0844 | 408 | consensus Transcription factor EVX1, contains HOX | 99.38 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.38 | |
| KOG0483 | 198 | consensus Transcription factor HEX, contains HOX a | 99.31 | |
| KOG0847 | 288 | consensus Transcription factor, contains HOX domai | 99.2 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.12 | |
| KOG0486 | 351 | consensus Transcription factor PTX1, contains HOX | 99.05 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 99.03 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 98.88 | |
| KOG0849 | 354 | consensus Transcription factor PRD and related pro | 98.59 | |
| KOG3802 | 398 | consensus Transcription factor OCT-1, contains POU | 98.38 | |
| KOG0775 | 304 | consensus Transcription factor SIX and related HOX | 98.2 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 98.09 | |
| KOG2252 | 558 | consensus CCAAT displacement protein and related h | 97.91 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 97.76 | |
| KOG0774 | 334 | consensus Transcription factor PBX and related HOX | 97.18 | |
| KOG1168 | 385 | consensus Transcription factor ACJ6/BRN-3, contain | 96.64 | |
| PF15057 | 124 | DUF4537: Domain of unknown function (DUF4537) | 95.64 | |
| PF11717 | 55 | Tudor-knot: RNA binding activity-knot of a chromod | 95.15 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 94.58 | |
| KOG0773 | 342 | consensus Transcription factor MEIS1 and related H | 94.37 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 93.34 | |
| PLN00104 | 450 | MYST -like histone acetyltransferase; Provisional | 92.92 | |
| cd00024 | 55 | CHROMO Chromatin organization modifier (chromo) do | 92.64 | |
| cd04508 | 48 | TUDOR Tudor domains are found in many eukaryotic o | 90.79 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 90.14 | |
| smart00298 | 55 | CHROMO Chromatin organization modifier domain. | 89.01 | |
| smart00333 | 57 | TUDOR Tudor domain. Domain of unknown function pre | 88.61 | |
| PF00385 | 55 | Chromo: Chromo (CHRromatin Organisation MOdifier) | 88.59 | |
| PF02820 | 73 | MBT: mbt repeat; InterPro: IPR004092 The function | 88.56 | |
| smart00561 | 96 | MBT Present in Drosophila Scm, l(3)mbt, and verteb | 87.54 | |
| PF12824 | 164 | MRP-L20: Mitochondrial ribosomal protein subunit L | 86.62 | |
| PF05641 | 68 | Agenet: Agenet domain; InterPro: IPR008395 This do | 85.9 | |
| smart00333 | 57 | TUDOR Tudor domain. Domain of unknown function pre | 85.85 | |
| PF12148 | 85 | DUF3590: Protein of unknown function (DUF3590); In | 84.09 | |
| PF11717 | 55 | Tudor-knot: RNA binding activity-knot of a chromod | 83.23 | |
| smart00743 | 61 | Agenet Tudor-like domain present in plant sequence | 82.33 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 80.46 |
| >KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.79 E-value=5.5e-20 Score=167.44 Aligned_cols=63 Identities=21% Similarity=0.298 Sum_probs=58.8
Q ss_pred CCCCCccccCHHHHHHHHHHHHhccCCCCCHHHHHHHHHHhCCCccccCCcccccchhhhhhhcchhhhhhcccC
Q 024359 6 SNGGPAFRFNPAEVTEMEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIRAKSIK 80 (268)
Q Consensus 6 s~~~pRt~FT~~Qv~eLEk~F~~~~~~yp~~~~rq~LA~~fnlS~~RaGK~~lt~kQVk~WFQNRR~k~Kkk~~~ 80 (268)
..++.||.||..|+.||||+|.. |+||++..|.+||..|+|+ |.|||||||||||||||....
T Consensus 158 ~~kR~RtayT~~QllELEkEFhf--N~YLtR~RRiEiA~~L~Lt----------ErQIKIWFQNRRMK~Kk~~k~ 220 (261)
T KOG0489|consen 158 KSKRRRTAFTRYQLLELEKEFHF--NKYLTRSRRIEIAHALNLT----------ERQIKIWFQNRRMKWKKENKA 220 (261)
T ss_pred CCCCCCcccchhhhhhhhhhhcc--ccccchHHHHHHHhhcchh----------HHHHHHHHHHHHHHHHHhhcc
Confidence 46899999999999999999999 6999999999999999965 699999999999999988854
|
|
| >KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0485 consensus Transcription factor NKX-5 | Back alignment and domain information |
|---|
| >KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG2251 consensus Homeobox transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0847 consensus Transcription factor, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >PF15057 DUF4537: Domain of unknown function (DUF4537) | Back alignment and domain information |
|---|
| >PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >PLN00104 MYST -like histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus | Back alignment and domain information |
|---|
| >cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >smart00298 CHROMO Chromatin organization modifier domain | Back alignment and domain information |
|---|
| >smart00333 TUDOR Tudor domain | Back alignment and domain information |
|---|
| >PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation | Back alignment and domain information |
|---|
| >PF02820 MBT: mbt repeat; InterPro: IPR004092 The function of the malignant brain tumor (MBT) repeat is unknown, but is found in a number of nuclear proteins involved in transcriptional repression | Back alignment and domain information |
|---|
| >smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 | Back alignment and domain information |
|---|
| >PF12824 MRP-L20: Mitochondrial ribosomal protein subunit L20; InterPro: IPR024388 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] | Back alignment and domain information |
|---|
| >smart00333 TUDOR Tudor domain | Back alignment and domain information |
|---|
| >PF12148 DUF3590: Protein of unknown function (DUF3590); InterPro: IPR021991 This domain is found in eukaryotes, and is typically between 83 and 97 amino acids in length | Back alignment and domain information |
|---|
| >PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F | Back alignment and domain information |
|---|
| >smart00743 Agenet Tudor-like domain present in plant sequences | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 268 | |||
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 5e-04 |
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
Score = 37.3 bits (86), Expect = 5e-04
Identities = 17/83 (20%), Positives = 34/83 (40%), Gaps = 7/83 (8%)
Query: 12 FRFNPAEVTEMEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMK-----QVWNW 66
F + + ME E+ P +A + ++ GK + ++ +V+NW
Sbjct: 12 FTWRKECLAVMESYFNENQY--PDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNW 69
Query: 67 FQNRRYAIRAKSIKSPGKLNVTP 89
F NRR I+ ++ + + P
Sbjct: 70 FANRRKEIKRRANIAAILESSGP 92
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.79 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.76 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.76 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.75 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.75 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.75 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.75 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.75 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.75 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.75 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.74 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.74 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.74 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.74 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.74 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.74 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.73 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.73 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.73 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.73 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.73 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.72 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.72 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.72 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.72 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.72 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.72 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.71 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.71 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.71 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.71 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.71 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.71 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.71 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.71 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.71 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.71 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.7 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.7 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.7 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.7 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.7 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.69 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.69 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.69 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.69 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.68 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.68 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.68 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.68 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.66 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.65 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.65 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.64 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.64 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.64 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.63 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.63 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.63 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.63 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.63 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.62 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.62 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.62 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.62 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.6 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.6 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.59 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.59 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.54 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.53 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.48 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.41 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.35 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 99.27 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.18 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.12 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.57 | |
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 96.37 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 96.1 | |
| 3fdr_A | 94 | Tudor and KH domain-containing protein; TDRD2, str | 95.83 | |
| 2ro0_A | 92 | Histone acetyltransferase ESA1; HAT, chromodomain, | 95.69 | |
| 2eko_A | 87 | Histone acetyltransferase htatip; chromo domain, h | 94.75 | |
| 4hae_A | 81 | CDY-like 2, chromodomain Y-like protein 2; protein | 94.33 | |
| 2rnz_A | 94 | Histone acetyltransferase ESA1; HAT, chromodomain, | 94.19 | |
| 2bud_A | 92 | Males-absent on the first protein; transferase, MO | 94.11 | |
| 2eqm_A | 88 | PHD finger protein 20-like 1; structural genomics, | 94.08 | |
| 3s6w_A | 54 | Tudor domain-containing protein 3; methylated argi | 94.02 | |
| 3db3_A | 161 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 93.95 | |
| 1mhn_A | 59 | SurviVal motor neuron protein; SMN, SMA, spinal mu | 93.85 | |
| 3oa6_A | 110 | MALE-specific lethal 3 homolog; chromodomain, MSL3 | 93.71 | |
| 2diq_A | 110 | Tudor and KH domain-containing protein; tudor doma | 93.57 | |
| 3pnw_C | 77 | Tudor domain-containing protein 3; FAB, structural | 93.23 | |
| 1wgs_A | 133 | MYST histone acetyltransferase 1; tudor domain, MY | 92.9 | |
| 2lcc_A | 76 | AT-rich interactive domain-containing protein 4A; | 92.89 | |
| 1g5v_A | 88 | SurviVal motor neuron protein 1; mRNA processing, | 92.58 | |
| 4a4f_A | 64 | SurviVal of motor neuron-related-splicing factor; | 92.28 | |
| 2d9t_A | 78 | Tudor domain-containing protein 3; structural geno | 91.87 | |
| 3ntk_A | 169 | Maternal protein tudor; tudor domain, OB-fold, GER | 91.5 | |
| 2equ_A | 74 | PHD finger protein 20-like 1; tudor domain, struct | 91.11 | |
| 2rsn_A | 75 | Chromo domain-containing protein 1; chromodomain, | 91.09 | |
| 4a4f_A | 64 | SurviVal of motor neuron-related-splicing factor; | 90.79 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 90.61 | |
| 4b9w_A | 201 | TDRD1, tudor domain-containing protein 1; replicat | 90.05 | |
| 3p8d_A | 67 | Medulloblastoma antigen MU-MB-50.72; tudor domain, | 89.94 | |
| 2f5k_A | 102 | MORF-related gene 15 isoform 1; beta barrel, gene | 89.87 | |
| 4b9x_A | 226 | TDRD1, tudor domain-containing protein 1; replicat | 89.38 | |
| 3qii_A | 85 | PHD finger protein 20; tudor domain, structural ge | 89.34 | |
| 2lcc_A | 76 | AT-rich interactive domain-containing protein 4A; | 89.06 | |
| 1g5v_A | 88 | SurviVal motor neuron protein 1; mRNA processing, | 88.43 | |
| 3m9q_A | 101 | Protein MALE-specific lethal-3; chromodomain, MSL3 | 87.95 | |
| 1mhn_A | 59 | SurviVal motor neuron protein; SMN, SMA, spinal mu | 87.88 | |
| 3m9p_A | 110 | MALE-specific lethal 3 homolog; chromodomain, MSL3 | 87.75 | |
| 3sd4_A | 69 | PHD finger protein 20; tudor domain, transcription | 87.74 | |
| 3pnw_C | 77 | Tudor domain-containing protein 3; FAB, structural | 87.49 | |
| 2lrq_A | 85 | Protein MRG15, NUA4 complex subunit EAF3 homolog; | 87.26 | |
| 1wjq_A | 107 | KIAA1798 protein; MBT domain, structural genomics, | 87.19 | |
| 2f5k_A | 102 | MORF-related gene 15 isoform 1; beta barrel, gene | 86.38 | |
| 2ldm_A | 81 | Uncharacterized protein; PHF20, tudor domain, epig | 86.37 | |
| 2hqx_A | 246 | P100 CO-activator tudor domain; human P100 tudor d | 86.13 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 85.6 | |
| 3s6w_A | 54 | Tudor domain-containing protein 3; methylated argi | 85.54 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 85.22 | |
| 2rso_A | 92 | Chromatin-associated protein SWI6; chromodomain, s | 84.11 | |
| 1wjr_A | 127 | KIAA1617 protein; MBT domain, structural genomics, | 84.09 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 81.36 | |
| 1g6z_A | 70 | CLR4 protein; transferase; NMR {Schizosaccharomyce | 81.25 | |
| 1wgs_A | 133 | MYST histone acetyltransferase 1; tudor domain, MY | 81.06 | |
| 2wac_A | 218 | CG7008-PA; unknown function, tudor, beta-barrel, n | 81.04 | |
| 2dnt_A | 78 | Chromodomain protein, Y chromosome-like, isoform B | 80.9 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 80.54 |
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
Probab=99.79 E-value=2e-19 Score=139.18 Aligned_cols=75 Identities=24% Similarity=0.364 Sum_probs=69.8
Q ss_pred CCCCCCCccccCHHHHHHHHHHHHhccCCCCCHHHHHHHHHHhC-----CCccccCCcccccchhhhhhhcchhhhhhcc
Q 024359 4 PPSNGGPAFRFNPAEVTEMEGILQEHHNAMPSREILVALAEKFS-----ESPERKGKIMVQMKQVWNWFQNRRYAIRAKS 78 (268)
Q Consensus 4 Pps~~~pRt~FT~~Qv~eLEk~F~~~~~~yp~~~~rq~LA~~fn-----lS~~RaGK~~lt~kQVk~WFQNRR~k~Kkk~ 78 (268)
.+..++.|+.||+.||..||+.|+. ++||+..+|++||+.+| .+.+++|+..|+++||++||||||+|+|++.
T Consensus 4 ~~~~rr~R~~ft~~ql~~Le~~F~~--~~yP~~~~r~~lA~~l~~~~~~~~~~~~~~~~ls~~qV~~WFqNRR~k~kr~~ 81 (95)
T 2cuf_A 4 GSSGRGSRFTWRKECLAVMESYFNE--NQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRA 81 (95)
T ss_dssp SSCCCCCSCCCCHHHHHHHHHHHHH--CSSCCHHHHHHHHHHHHHHHCCTTCCCCTTTCCCHHHHHHHHHHHHHHHHHHH
T ss_pred CCCCCCCCCcCCHHHHHHHHHHHhc--CCCCCHHHHHHHHHHHCchhhcccccccccCcCCHHHHHHHHHHHHHHHHHHh
Confidence 4466899999999999999999999 69999999999999999 7888899999999999999999999999988
Q ss_pred cC
Q 024359 79 IK 80 (268)
Q Consensus 79 ~~ 80 (268)
..
T Consensus 82 ~~ 83 (95)
T 2cuf_A 82 NI 83 (95)
T ss_dssp HC
T ss_pred hc
Confidence 64
|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 | Back alignment and structure |
|---|
| >2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A | Back alignment and structure |
|---|
| >3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* | Back alignment and structure |
|---|
| >3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* | Back alignment and structure |
|---|
| >1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* | Back alignment and structure |
|---|
| >3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* | Back alignment and structure |
|---|
| >2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 | Back alignment and structure |
|---|
| >2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* | Back alignment and structure |
|---|
| >2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* | Back alignment and structure |
|---|
| >2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A | Back alignment and structure |
|---|
| >4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 | Back alignment and structure |
|---|
| >3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 | Back alignment and structure |
|---|
| >1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* | Back alignment and structure |
|---|
| >3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A | Back alignment and structure |
|---|
| >3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 | Back alignment and structure |
|---|
| >2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A | Back alignment and structure |
|---|
| >2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 | Back alignment and structure |
|---|
| >2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 268 | ||||
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 1e-05 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 5e-05 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 2e-04 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 3e-04 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 9e-04 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 0.002 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 0.002 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 0.002 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 0.004 |
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: mat alpha2 Homeodomain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 40.2 bits (94), Expect = 1e-05
Identities = 15/68 (22%), Positives = 24/68 (35%), Gaps = 13/68 (19%)
Query: 13 RFNPAEVTEMEGILQEH-HNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRR 71
RF V +E ++ N + L L + + Q+ NW NRR
Sbjct: 4 RFTKENVRILESWFAKNIENPYLDTKGLENLMKN----------TSLSRIQIKNWVSNRR 53
Query: 72 YAIRAKSI 79
+ K+I
Sbjct: 54 R--KEKTI 59
|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.79 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.79 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.78 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.78 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.77 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.77 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.77 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.76 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.75 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.74 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.74 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.73 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.72 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.71 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.71 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.71 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.7 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.7 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.69 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.68 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.68 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.68 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.66 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.66 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.64 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.63 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.63 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.53 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.51 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.45 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.44 | |
| d2buda1 | 88 | Putative histone acetyltransferase MOF {Fruit fly | 95.56 | |
| d1wgsa_ | 133 | Probable histone acetyltransferase MYST1 {Mouse (M | 95.27 | |
| d2diqa1 | 97 | Tudor and KH domain-containing protein TDRKH {Huma | 95.15 | |
| d2hqxa1 | 90 | P100 co-activator, SND1 {Human (Homo sapiens) [Tax | 94.29 | |
| d2d9ta1 | 60 | Tudor domain-containing protein 3, TDRD3 {Mouse (M | 93.91 | |
| d1mhna_ | 59 | Survival motor neuron protein 1, smn {Human (Homo | 92.76 | |
| d2f5ka1 | 83 | Mortality factor 4-like protein 1, MRG15 {Human (H | 92.34 | |
| d2dnta1 | 66 | Chromodomain protein, Y-like isoform {Human (Homo | 91.73 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 90.13 | |
| d1pfba_ | 55 | Polycomb protein, Pc {Fruit fly (Drosophila melano | 88.94 | |
| d2dnva1 | 52 | Chromobox protein homolog 8 {Mouse (Mus musculus) | 87.76 | |
| d1q3la_ | 52 | Heterochromatin protein 1, HP1 {Fruit fly (Drosoph | 86.18 | |
| d2d9ta1 | 60 | Tudor domain-containing protein 3, TDRD3 {Mouse (M | 85.44 | |
| d1g6za_ | 70 | Histone methyltransferase clr4, chromo domain {Fis | 85.12 | |
| d1wjqa_ | 107 | Lethal(3)malignant brain tumor-like 3 protein, L3M | 84.98 | |
| d1guwa_ | 73 | Heterochromatin protein 1, HP1 {Mouse (Mus musculu | 84.54 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 82.39 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 81.35 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 81.25 | |
| d2f5ka1 | 83 | Mortality factor 4-like protein 1, MRG15 {Human (H | 81.2 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 80.71 | |
| d1oz2a1 | 110 | Lethal(3)malignant brain tumor-like protein {Human | 80.6 | |
| d1oz2a2 | 108 | Lethal(3)malignant brain tumor-like protein {Human | 80.32 |
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-b13 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79 E-value=4.2e-20 Score=132.29 Aligned_cols=57 Identities=21% Similarity=0.311 Sum_probs=53.6
Q ss_pred CCCccccCHHHHHHHHHHHHhccCCCCCHHHHHHHHHHhCCCccccCCcccccchhhhhhhcchhhhhh
Q 024359 8 GGPAFRFNPAEVTEMEGILQEHHNAMPSREILVALAEKFSESPERKGKIMVQMKQVWNWFQNRRYAIRA 76 (268)
Q Consensus 8 ~~pRt~FT~~Qv~eLEk~F~~~~~~yp~~~~rq~LA~~fnlS~~RaGK~~lt~kQVk~WFQNRR~k~Kk 76 (268)
+++|+.||++|+..||+.|.. ++||+.+.|++||..+||+ ++||++||||||+|+||
T Consensus 2 rr~Rt~ft~~Q~~~Le~~F~~--~~yp~~~~r~~LA~~l~l~----------~~qV~vWFqNrR~k~kk 58 (58)
T d2craa1 2 RKKRIPYSKGQLRELEREYAA--NKFITKDKRRKISAATSLS----------ERQITIWFQNRRVKEKK 58 (58)
T ss_dssp CCSCCCSCHHHHHHHHHHHHH--CSSCCHHHHHHHHHHTCCC----------HHHHHHHHHHHHHTTTS
T ss_pred CCCCCCCCHHHHHHHHHHHhh--cCCCCHHHHHHHHHHcCCC----------HHHeeecccchhhhccC
Confidence 678999999999999999999 6999999999999999976 59999999999999875
|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|