Citrus Sinensis ID: 024367


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MAPDITPTTITKTTSLSKAPSLPKRAYVTFLAGDGDYWKGVVGLVKGLRKAKSKYPLLVAMLPDVPEEHRKILIEQGCILREIEPVYPPENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMDCFCEKTWSHTPQFKIGYCQQCPDKVKWPAELGPKPALYFNAGMFVFEPSLSTYHDLLETVQITTPTSFAEQDFLNMYFRDIYRPIPPIYNLVVAMLWRHPENVEADKAKVVHYCAAVSTIL
cccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHcEEEEcccccccEEEEEccccHHccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEECccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccHHHHHHcccccccccccEEEEEEccccccc
************************RAYVTFLAGDGDYWKGVVGLVKGLRKAKSKYPLLVAMLPDVPEEHRKILIEQGCILREIEPVYPPENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMDCFCEKTWSHTPQFKIGYCQQCPDKVKWPAELGPKPALYFNAGMFVFEPSLSTYHDLLETVQITTPTSFAEQDFLNMYFRDIYRPIPPIYNLVVAMLWRHPENVEADKAKVVHYCAAVSTIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPDITPTTITKTTSLSKAPSLPKRAYVTFLAGDGDYWKGVVGLVKGLRKAKSKYPLLVAMLPDVPEEHRKILIEQGCILREIEPVYPPENQTQFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFDNIDHLFDLPDGYFYAVMDCFCEKTWSHTPQFKIGYCQQCPDKVKWPAELGPKPALYFNAGMFVFEPSLSTYHDLLETVQITTPTSFAEQDFLNMYFRDIYRPIPPIYNLVVAMLWRHPENVEADKAKVVHYCAAVSTIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Galactinol synthase 2 Galactinol synthase involved in the biosynthesis of raffinose family oligosaccharides (RFOs) that function as osmoprotectants. Promotes stress tolerance of factors such as drought, chilling, salinity and methylviologen (MV), a superoxide radical generating drug, by mediating an increase in levels of the endogenous osmoprotective compounds, galactinol and raffinose.probableQ9FXB2
Galactinol synthase 1 Major galactinol synthase mainly involved in the biosynthesis of storage raffinose family oligosaccharides (RFOs) that function as osmoprotectants. May promote plant stress tolerance.probableQ9XGN4
Galactinol synthase 2 (Fragment) May promote plant stress tolerance (By similarity). Galactinol synthase mainly involved in the biosynthesis of transport raffinose family oligosaccharides (RFOs) that function as osmoprotectants.probableQ9XGN3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G9R, chain A
Confidence level:very confident
Coverage over the Query: 30-267
View the alignment between query and template
View the model in PyMOL
Template: 1ZCV, chain A
Confidence level:probable
Coverage over the Query: 22-139,165-262
View the alignment between query and template
View the model in PyMOL