Citrus Sinensis ID: 024380
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 268 | ||||||
| 11596188 | 268 | lectin-related protein precursor [Citrus | 1.0 | 1.0 | 1.0 | 1e-151 | |
| 359476128 | 661 | PREDICTED: probable L-type lectin-domain | 0.940 | 0.381 | 0.413 | 2e-39 | |
| 255548946 | 584 | conserved hypothetical protein [Ricinus | 0.813 | 0.373 | 0.386 | 5e-31 | |
| 356553507 | 716 | PREDICTED: probable L-type lectin-domain | 0.798 | 0.298 | 0.311 | 6e-22 | |
| 356565399 | 645 | PREDICTED: probable L-type lectin-domain | 0.798 | 0.331 | 0.304 | 8e-20 | |
| 296082025 | 569 | unnamed protein product [Vitis vinifera] | 0.477 | 0.224 | 0.436 | 6e-19 | |
| 326498453 | 684 | predicted protein [Hordeum vulgare subsp | 0.906 | 0.355 | 0.297 | 9e-19 | |
| 224114497 | 663 | predicted protein [Populus trichocarpa] | 0.910 | 0.368 | 0.314 | 3e-18 | |
| 224056469 | 664 | predicted protein [Populus trichocarpa] | 0.828 | 0.334 | 0.327 | 6e-18 | |
| 225441463 | 654 | PREDICTED: probable L-type lectin-domain | 0.902 | 0.370 | 0.317 | 6e-18 |
| >gi|11596188|gb|AAG38522.1|AF283537_1 lectin-related protein precursor [Citrus x paradisi] | Back alignment and taxonomy information |
|---|
Score = 541 bits (1393), Expect = e-151, Method: Compositional matrix adjust.
Identities = 268/268 (100%), Positives = 268/268 (100%)
Query: 1 MIFLLLLSVFLRGASSSILSEDTPISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGP 60
MIFLLLLSVFLRGASSSILSEDTPISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGP
Sbjct: 1 MIFLLLLSVFLRGASSSILSEDTPISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGP 60
Query: 61 PPNLPIRKVGRVLYGKPLSLQRSFIDTTITIKISRHQNYTDRAGDGMTFIFASDKNGPSA 120
PPNLPIRKVGRVLYGKPLSLQRSFIDTTITIKISRHQNYTDRAGDGMTFIFASDKNGPSA
Sbjct: 61 PPNLPIRKVGRVLYGKPLSLQRSFIDTTITIKISRHQNYTDRAGDGMTFIFASDKNGPSA 120
Query: 121 KGVGEYLGLQSSPGDKFPPLAVELDTCLNKNLNDPDDNHIGIDINGIESNPVNSLLDVDL 180
KGVGEYLGLQSSPGDKFPPLAVELDTCLNKNLNDPDDNHIGIDINGIESNPVNSLLDVDL
Sbjct: 121 KGVGEYLGLQSSPGDKFPPLAVELDTCLNKNLNDPDDNHIGIDINGIESNPVNSLLDVDL 180
Query: 181 KSGRAIQVRIYYNPDFGQLSIYAAYSGETLVKVIEKPINLSDIIPTPVYVGFTAATGDFL 240
KSGRAIQVRIYYNPDFGQLSIYAAYSGETLVKVIEKPINLSDIIPTPVYVGFTAATGDFL
Sbjct: 181 KSGRAIQVRIYYNPDFGQLSIYAAYSGETLVKVIEKPINLSDIIPTPVYVGFTAATGDFL 240
Query: 241 ESHEVINWTFNSFPVPPSLKEKNLVMPI 268
ESHEVINWTFNSFPVPPSLKEKNLVMPI
Sbjct: 241 ESHEVINWTFNSFPVPPSLKEKNLVMPI 268
|
Source: Citrus x paradisi Species: Citrus x paradisi Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359476128|ref|XP_002282629.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255548946|ref|XP_002515529.1| conserved hypothetical protein [Ricinus communis] gi|223545473|gb|EEF46978.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356553507|ref|XP_003545097.1| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356565399|ref|XP_003550928.1| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296082025|emb|CBI21030.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|326498453|dbj|BAJ98654.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|224114497|ref|XP_002316778.1| predicted protein [Populus trichocarpa] gi|222859843|gb|EEE97390.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224056469|ref|XP_002298872.1| predicted protein [Populus trichocarpa] gi|222846130|gb|EEE83677.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225441463|ref|XP_002279820.1| PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 268 | ||||||
| UNIPROTKB|P42088 | 240 | P42088 "Lectin" [Leucomphalos | 0.809 | 0.904 | 0.287 | 3e-14 | |
| TAIR|locus:2170224 | 652 | AT5G06740 [Arabidopsis thalian | 0.813 | 0.334 | 0.276 | 8.2e-14 | |
| TAIR|locus:2143528 | 711 | AT5G03140 [Arabidopsis thalian | 0.917 | 0.345 | 0.251 | 1.1e-11 | |
| TAIR|locus:2162212 | 681 | AT5G55830 [Arabidopsis thalian | 0.873 | 0.343 | 0.281 | 4.2e-11 | |
| TAIR|locus:2099941 | 684 | AT3G55550 [Arabidopsis thalian | 0.869 | 0.340 | 0.265 | 8.3e-11 | |
| UNIPROTKB|P02870 | 275 | P02870 "Lectin" [Lens culinari | 0.869 | 0.847 | 0.273 | 4.1e-09 | |
| TAIR|locus:2138381 | 686 | AT4G04960 [Arabidopsis thalian | 0.902 | 0.352 | 0.267 | 2.9e-08 | |
| TAIR|locus:2097613 | 693 | AT3G08870 [Arabidopsis thalian | 0.276 | 0.106 | 0.373 | 1.5e-07 | |
| UNIPROTKB|Q70DJ5 | 280 | Q70DJ5 "Alpha-methyl-mannoside | 0.820 | 0.785 | 0.247 | 2.4e-07 | |
| TAIR|locus:2083986 | 715 | AT3G53380 [Arabidopsis thalian | 0.865 | 0.324 | 0.247 | 8.1e-07 |
| UNIPROTKB|P42088 P42088 "Lectin" [Leucomphalos mildbraedii (taxid:28956)] | Back alignment and assigned GO terms |
|---|
Score = 183 (69.5 bits), Expect = 3.0e-14, P = 3.0e-14
Identities = 69/240 (28%), Positives = 108/240 (45%)
Query: 25 ISFSFPSFAKDSCDNKTLICYG--AIESSGALSITPGPPPNLPIR-KVGRVLYGKPLSLQ 81
+ F+F F D LI G ++ S+ AL +T P VGR LY P+ L
Sbjct: 4 VCFTFTDFESGQQD---LIFQGDASVGSNKALQLTKVDSKGNPQGGSVGRALYTAPIRLW 60
Query: 82 RSF-----IDTTITIKISRHQNYTDRAGDGMTFIFAS-DKNGPSAKGVGEYLGL---QSS 132
+S +TT T IS+ + T A +TF AS D PS G G LGL ++
Sbjct: 61 QSSSLVASFETTFTFSISQGSS-TPAAA--LTFFIASPDTKIPSGSG-GRLLGLFGSSNN 116
Query: 133 PGDKFPPLAVELDTCLNKNLXXXXXXXXXXXXXXXESNPVNSLLDVDLKSGRAIQVRIYY 192
G +AVE DT N ++ S + D ++G+ I Y
Sbjct: 117 AGSDNGVVAVEFDTYPNTDIGDPNYRHIGIDVNSIRSKAASKW---DWQNGKTATAHISY 173
Query: 193 NPDFGQLSIYAAYSGETLVKVIEKPINLSDIIPTPVYVGFTAATGDFLESHEVINWTFNS 252
N +LS+ ++Y + V V+ + L+++ P V VGF+A TG + +++ ++ W+F S
Sbjct: 174 NSASKRLSVVSSYPNSSPV-VVSFDVELNNVGPPDVRVGFSATTGQYTQTNNILAWSFRS 232
|
|
| TAIR|locus:2170224 AT5G06740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162212 AT5G55830 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099941 AT3G55550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P02870 P02870 "Lectin" [Lens culinaris (taxid:3864)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2138381 AT4G04960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2097613 AT3G08870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q70DJ5 Q70DJ5 "Alpha-methyl-mannoside-specific lectin" [Arachis hypogaea (taxid:3818)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083986 AT3G53380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00032635001 | SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (599 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 268 | |||
| pfam00139 | 231 | pfam00139, Lectin_legB, Legume lectin domain | 7e-69 | |
| cd06899 | 236 | cd06899, lectin_legume_LecRK_Arcelin_ConA, legume | 6e-62 | |
| cd01951 | 223 | cd01951, lectin_L-type, legume lectins | 8e-37 |
| >gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain | Back alignment and domain information |
|---|
Score = 212 bits (541), Expect = 7e-69
Identities = 85/241 (35%), Positives = 121/241 (50%), Gaps = 22/241 (9%)
Query: 23 TPISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGPPPNLPIRKVGRVLYGKPLSL-- 80
+ +SF++ F+ S N TL + +G L +T N+ GR LY KP+ L
Sbjct: 1 STVSFNYNGFSNVS--NLTLQGDATVLPNGLLQLT-----NVTNNSAGRALYSKPIRLWD 53
Query: 81 -----QRSFIDTTITIKISRHQNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGLQSSPGD 135
SF T+ I + GDG+ F A P A G YLGL +S +
Sbjct: 54 SSTGKVASF-STSFVFAIKNI-PKSTNGGDGLAFFLAPSGTQPGASS-GGYLGLFNSSNN 110
Query: 136 KFP---PLAVELDTCLNKNLNDPDDNHIGIDINGIESNPVNSLL--DVDLKSGRAIQVRI 190
+AVE DT LN ND DDNH+GID+N I S S +DL SG+ IQV I
Sbjct: 111 GNSSNHIVAVEFDTFLNPEFNDIDDNHVGIDVNSIISVASESASFVPLDLNSGKPIQVWI 170
Query: 191 YYNPDFGQLSIYAAYSGETLVKVIEKPINLSDIIPTPVYVGFTAATGDFLESHEVINWTF 250
Y+ +LS+ AY + ++ ++LS ++P VYVGF+A+TG ESH V++W+F
Sbjct: 171 DYDGSSKRLSVTLAYPNKPKRPLLSASVDLSTVLPEWVYVGFSASTGGATESHYVLSWSF 230
Query: 251 N 251
+
Sbjct: 231 S 231
|
Length = 231 |
| >gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|173886 cd01951, lectin_L-type, legume lectins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| cd06899 | 236 | lectin_legume_LecRK_Arcelin_ConA legume lectins, l | 100.0 | |
| PF00139 | 236 | Lectin_legB: Legume lectin domain; InterPro: IPR00 | 100.0 | |
| cd01951 | 223 | lectin_L-type legume lectins. The L-type (legume-t | 100.0 | |
| cd07308 | 218 | lectin_leg-like legume-like lectins: ERGIC-53, ERG | 99.95 | |
| cd06902 | 225 | lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran | 99.92 | |
| cd06901 | 248 | lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr | 99.91 | |
| cd06903 | 215 | lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem | 99.83 | |
| PF03388 | 229 | Lectin_leg-like: Legume-like lectin family; InterP | 99.83 | |
| KOG3838 | 497 | consensus Mannose lectin ERGIC-53, involved in gly | 99.78 | |
| KOG3839 | 351 | consensus Lectin VIP36, involved in the transport | 99.65 | |
| cd06900 | 255 | lectin_VcfQ VcfQ bacterial pilus biogenesis protei | 99.13 | |
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 86.86 |
| >cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.1e-54 Score=382.71 Aligned_cols=216 Identities=35% Similarity=0.575 Sum_probs=190.8
Q ss_pred eeEEcCCCCCCCCCccccccccCeEEecceEeCCC-CC--CCCC--CCceEEEEeccceeccc------CCeEEEEEEEE
Q 024380 25 ISFSFPSFAKDSCDNKTLICYGAIESSGALSITPG-PP--PNLP--IRKVGRVLYGKPLSLQR------SFIDTTITIKI 93 (268)
Q Consensus 25 ~~F~f~~F~~~~~~~~~~~~~~~l~l~G~A~~~~~-~i--T~~~--~~~~G~~~y~~Pi~l~~------~sFst~F~F~I 93 (268)
++|+|++|..+. ++|.|+|+|.+..+ .+ |++. ++++|||||++||++|+ ++|+|+|+|+|
T Consensus 1 ~~f~f~~f~~~~---------~~l~l~G~A~~~~~~~i~LT~~~~~~~~~G~v~y~~pi~l~~~~~~~~~sFst~F~F~i 71 (236)
T cd06899 1 LSFNFNGFSSDQ---------SNLTLQGDATISSNGALQLTNDTSPASSVGRALYSKPVRLWDSTTGKVASFSTSFSFSI 71 (236)
T ss_pred CceecCCCCCCC---------CCEEEecceEcCCCCeEEecCCCCCCcceEEEEeCCCEEeecCCCCCceeEEEEEEEEE
Confidence 479999998753 78999999999844 45 9888 99999999999999996 69999999999
Q ss_pred eecccCCCCCCCceEEEEecCCCCCCCCCCCccccCCCC---CCCCCCcEEEEEeccCc-CCCCCCCCCeeEEecCCCcc
Q 024380 94 SRHQNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGLQSS---PGDKFPPLAVELDTCLN-KNLNDPDDNHIGIDINGIES 169 (268)
Q Consensus 94 ~~~~~~~~~~gDGlAF~l~~~~~~~~~~~~Gg~lGl~~~---~~~~~~~vAVEFDT~~N-~~~~Dp~~~HVgI~~ns~~s 169 (268)
.+ +....+||||||||+|++ ..+.+..|++|||.+. +...++.||||||||+| ++ +||+.+||||++|++.+
T Consensus 72 ~~--~~~~~~gdGlAF~i~~~~-~~~~~~~G~~lG~~~~~~~~~~~~~~vAVEFDT~~n~~~-~D~~~nHigIdvn~~~S 147 (236)
T cd06899 72 TP--PNPSLGGDGLAFFLAPTD-SLPPASSGGYLGLFNSSNNGNSSNHIVAVEFDTFQNPEF-GDPDDNHVGIDVNSLVS 147 (236)
T ss_pred Ec--CCCCCCCCeEEEEEecCC-CCCCCCCcceeeeecCCCCCCcccceEEEEeecccCccc-CCCCCCeEEEEcCCccc
Confidence 98 555689999999999987 3344688999999876 23567899999999999 66 79999999999999988
Q ss_pred ccccccc--ccccCCCceEEEEEEEecCCcEEEEEEEec--CCCceeEEEEeeeCCCCCCCceEEEEEeecCCcccceEE
Q 024380 170 NPVNSLL--DVDLKSGRAIQVRIYYNPDFGQLSIYAAYS--GETLVKVIEKPINLSDIIPTPVYVGFTAATGDFLESHEV 245 (268)
Q Consensus 170 ~~~~~~~--~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~--~~~~~~~ls~~idL~~~l~~~~yvGFSAsTG~~~~~h~I 245 (268)
..+..+. .++|.+|+.++|||+|++.+++|+|+|+.. .+|..|++++.+||+.+|+++|||||||+||+..|.|+|
T Consensus 148 ~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~i 227 (236)
T cd06899 148 VKAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYI 227 (236)
T ss_pred ceeeccccccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEEE
Confidence 7766652 345789999999999999999999999984 378899999999999999999999999999999999999
Q ss_pred EEEEEeeC
Q 024380 246 INWTFNSF 253 (268)
Q Consensus 246 ~sWsF~s~ 253 (268)
++|+|++.
T Consensus 228 ~sWsF~s~ 235 (236)
T cd06899 228 LSWSFSSN 235 (236)
T ss_pred EEEEEEcC
Confidence 99999985
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin |
| >PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported | Back alignment and domain information |
|---|
| >cd01951 lectin_L-type legume lectins | Back alignment and domain information |
|---|
| >cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 | Back alignment and domain information |
|---|
| >cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain | Back alignment and domain information |
|---|
| >cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates | Back alignment and domain information |
|---|
| >KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 268 | ||||
| 2fmd_A | 240 | Structural Basis Of Carbohydrate Recognition By Bow | 2e-11 | ||
| 1gz9_A | 239 | High-Resolution Crystal Structure Of Erythrina Cris | 4e-11 | ||
| 1lte_A | 239 | Structure Of A Legume Lectin With An Ordered N-Link | 8e-11 | ||
| 1sfy_A | 239 | Crystal Structure Of Recombinant Erythrina Corallod | 2e-10 | ||
| 3n35_A | 242 | Erythrina Corallodendron Lectin Mutant (Y106g) With | 3e-10 | ||
| 1fyu_A | 255 | Crystal Structure Of Erythrina Corallodendron Lecti | 3e-10 | ||
| 1ax0_A | 239 | Erythrina Corallodendron Lectin In Complex With N-A | 4e-10 | ||
| 3usu_A | 256 | Crystal Structure Of Butea Monosperma Seed Lectin L | 2e-09 | ||
| 3usu_B | 242 | Crystal Structure Of Butea Monosperma Seed Lectin L | 2e-09 | ||
| 1uzy_A | 242 | Erythrina Crystagalli Lectin Length = 242 | 3e-09 | ||
| 3ipv_B | 239 | Crystal Structure Of Spatholobus Parviflorus Seed L | 2e-08 | ||
| 3ujo_A | 281 | Galactose-Specific Seed Lectin From Dolichos Lablab | 2e-08 | ||
| 1fat_A | 252 | Phytohemagglutinin-L Length = 252 | 2e-08 | ||
| 2bqp_A | 234 | The Structure Of The Pea Lectin-D-Glucopyranose Com | 2e-08 | ||
| 1fay_A | 238 | Winged Bean Acidic Lectin Complexed With Methyl-Alp | 3e-08 | ||
| 1g8w_A | 233 | Improved Structure Of Phytohemagglutinin-L From The | 3e-08 | ||
| 3zvx_A | 261 | Structure Of The Lectin From Platypodium Elegans In | 4e-08 | ||
| 3ipv_A | 251 | Crystal Structure Of Spatholobus Parviflorus Seed L | 7e-08 | ||
| 1bjq_A | 253 | The Dolichos Biflorus Seed Lectin In Complex With A | 1e-07 | ||
| 2sba_A | 253 | Soybean Agglutinin Complexed With 2,6-Pentasacchari | 1e-07 | ||
| 1n47_A | 233 | Isolectin B4 From Vicia Villosa In Complex With The | 3e-07 | ||
| 1qnw_A | 242 | Lectin Ii From Ulex Europaeus Length = 242 | 3e-07 | ||
| 1ioa_A | 240 | Arcelin-5, A Lectin-Like Defense Protein From Phase | 1e-06 | ||
| 1n3o_A | 252 | Pterocarcpus Angolensis Lectin In Complex With Alph | 1e-06 | ||
| 1q8o_A | 252 | Pterocartpus Angolensis Lectin Pal In Complex With | 2e-06 | ||
| 1wbl_A | 241 | Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga | 3e-06 | ||
| 2e7q_A | 237 | Crystal Structure Of Basic Winged Bean Lectin In Co | 3e-06 | ||
| 1wbf_A | 242 | Winged Bean Lectin, Saccharide Free Form Length = 2 | 3e-06 | ||
| 2eig_A | 234 | Lotus Tetragonolobus Seed Lectin (Isoform) Length = | 4e-06 | ||
| 2je9_A | 239 | Crystal Structure Of Recombinant Dioclea Grandiflor | 7e-06 | ||
| 1gsl_A | 243 | Lectin (Fourth Isolated From (Griffonia Simplicifol | 7e-06 | ||
| 3sh3_A | 237 | Crystal Structure Of A Pro-Inflammatory Lectin From | 8e-06 | ||
| 2jec_A | 239 | Crystal Structure Of Recombinant Dioclea Grandiflor | 1e-05 | ||
| 1dgl_A | 237 | Lectin From Dioclea Grandiflora Complexed To Triman | 1e-05 | ||
| 2gdf_A | 237 | Crystal Structure Of Dioclea Violacea Seed Lectin L | 2e-05 | ||
| 2jdz_A | 239 | Crystal Structure Of Recombinant Dioclea Guianensis | 2e-05 | ||
| 2je7_A | 239 | Crystal Structure Of Recombinant Dioclea Guianensis | 2e-05 | ||
| 2zbj_A | 237 | Crystal Structure Of Dioclea Rostrata Lectin Length | 2e-05 | ||
| 1dbn_A | 239 | Maackia Amurensis Leukoagglutinin (Lectin) With Sia | 2e-05 | ||
| 3a0k_A | 237 | Crystal Structure Of An Antiflamatory Legume Lectin | 5e-05 | ||
| 3rrd_A | 237 | Native Structure Of Dioclea Virgata Lectin Length = | 5e-05 | ||
| 1h9w_A | 237 | Native Dioclea Guianensis Seed Lectin Length = 237 | 5e-05 | ||
| 1h9p_A | 237 | Crystal Structure Of Dioclea Guianensis Seed Lectin | 6e-05 | ||
| 1mvq_A | 236 | Cratylia Mollis Lectin (Isoform 1) In Complex With | 6e-05 | ||
| 1lul_A | 253 | Db58, A Legume Lectin From Dolichos Biflorus Length | 1e-04 | ||
| 3u4x_A | 236 | Crystal Structure Of A Lectin From Camptosema Pedic | 3e-04 | ||
| 2d3p_A | 236 | Cratylia Floribunda Seed Lectin Crystallized At Bas | 4e-04 | ||
| 1viw_B | 205 | Tenebrio Molitor Alpha-Amylase-Inhibitor Complex Le | 4e-04 | ||
| 1dhk_B | 223 | Structure Of Porcine Pancreatic Alpha-Amylase Lengt | 5e-04 | ||
| 1cn1_A | 237 | Crystal Structure Of Demetallized Concanavalin A. T | 8e-04 | ||
| 2cna_A | 237 | The Covalent And Three-Dimensional Structure Of Con | 8e-04 | ||
| 1ofs_B | 48 | Pea Lectin-sucrose Complex Length = 48 | 8e-04 | ||
| 1bqp_B | 47 | The Structure Of The Pea Lectin-D-Mannopyranose Com | 8e-04 | ||
| 2ow4_A | 237 | Crystal Structure Of A Lectin From Canavalia Mariti | 8e-04 | ||
| 2cwm_A | 237 | Native Crystal Structure Of No Releasing Inductive | 8e-04 | ||
| 1rin_D | 49 | X-Ray Crystal Structure Of A Pea Lectin-Trimannosid | 8e-04 | ||
| 2ovu_A | 237 | Crystal Strucure Of A Lectin From Canavalia Gladiat | 9e-04 | ||
| 1wuv_A | 237 | Crystal Structure Of Native Canavalia Gladiata Lect | 9e-04 | ||
| 1azd_A | 237 | Concanavalin From Canavalia Brasiliensis Length = 2 | 9e-04 |
| >pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 | Back alignment and structure |
|
| >pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 | Back alignment and structure |
| >pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 | Back alignment and structure |
| >pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 | Back alignment and structure |
| >pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 | Back alignment and structure |
| >pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 | Back alignment and structure |
| >pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 | Back alignment and structure |
| >pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 | Back alignment and structure |
| >pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 | Back alignment and structure |
| >pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 | Back alignment and structure |
| >pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 | Back alignment and structure |
| >pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 | Back alignment and structure |
| >pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 | Back alignment and structure |
| >pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 | Back alignment and structure |
| >pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 | Back alignment and structure |
| >pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 | Back alignment and structure |
| >pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 | Back alignment and structure |
| >pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 | Back alignment and structure |
| >pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 | Back alignment and structure |
| >pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 | Back alignment and structure |
| >pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 | Back alignment and structure |
| >pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 | Back alignment and structure |
| >pdb|1IOA|A Chain A, Arcelin-5, A Lectin-Like Defense Protein From Phaseolus Vulgaris Length = 240 | Back alignment and structure |
| >pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 | Back alignment and structure |
| >pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 | Back alignment and structure |
| >pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 | Back alignment and structure |
| >pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 | Back alignment and structure |
| >pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 | Back alignment and structure |
| >pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 | Back alignment and structure |
| >pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|1GSL|A Chain A, Lectin (Fourth Isolated From (Griffonia Simplicifolia)) Complex With Y Human Blood Group Determinant Length = 243 | Back alignment and structure |
| >pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 | Back alignment and structure |
| >pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 | Back alignment and structure |
| >pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 | Back alignment and structure |
| >pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 | Back alignment and structure |
| >pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 | Back alignment and structure |
| >pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 | Back alignment and structure |
| >pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 | Back alignment and structure |
| >pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 | Back alignment and structure |
| >pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 | Back alignment and structure |
| >pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 | Back alignment and structure |
| >pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 | Back alignment and structure |
| >pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 | Back alignment and structure |
| >pdb|1VIW|B Chain B, Tenebrio Molitor Alpha-Amylase-Inhibitor Complex Length = 205 | Back alignment and structure |
| >pdb|1DHK|B Chain B, Structure Of Porcine Pancreatic Alpha-Amylase Length = 223 | Back alignment and structure |
| >pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 | Back alignment and structure |
| >pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 | Back alignment and structure |
| >pdb|1OFS|B Chain B, Pea Lectin-sucrose Complex Length = 48 | Back alignment and structure |
| >pdb|1BQP|B Chain B, The Structure Of The Pea Lectin-D-Mannopyranose Complex Length = 47 | Back alignment and structure |
| >pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 | Back alignment and structure |
| >pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 | Back alignment and structure |
| >pdb|1RIN|D Chain D, X-Ray Crystal Structure Of A Pea Lectin-Trimannoside Complex At 2.6 Angstroms Resolution Length = 49 | Back alignment and structure |
| >pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 | Back alignment and structure |
| >pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 | Back alignment and structure |
| >pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 268 | |||
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 4e-45 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 1e-43 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 3e-42 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 4e-42 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 9e-42 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 2e-41 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 1e-40 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 1e-40 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 6e-40 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 1e-39 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 4e-39 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 6e-39 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 1e-38 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 1e-38 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 5e-38 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 1e-37 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 2e-37 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 2e-37 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 2e-35 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 4e-34 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 4e-32 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 3e-31 | |
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 2e-28 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 6e-25 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 1e-05 | |
| 2ltn_A | 181 | PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO | 2e-24 | |
| 2dur_A | 253 | VIP36;, vesicular integral-membrane protein VIP36; | 4e-17 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 2e-14 | |
| 1qmo_A | 113 | Mannose binding lectin, FRIL; crosslink, hematopoi | 4e-11 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 2e-09 | |
| 2a6v_A | 226 | EMP46P; beta sandwich, carbohydrate binding protei | 6e-08 | |
| 2a6z_A | 222 | EMP47P (FORM2); beta sandwich, carbohydrate bindin | 4e-06 | |
| 2a6y_A | 256 | EMP47P (FORM1); beta sandwich, carbohydrate bindin | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 |
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 | Back alignment and structure |
|---|
Score = 151 bits (381), Expect = 4e-45
Identities = 58/239 (24%), Positives = 99/239 (41%), Gaps = 22/239 (9%)
Query: 23 TPISFSFPSFAKDSCDNKTLICYG--AIESSGALSITPGPPPNLPIRKVGRVLYGKPLSL 80
+SF+F SF++ N + G + S+G + +T N VGRVLY P+ +
Sbjct: 2 ETVSFNFNSFSEG---NPAINFQGDVTVLSNGNIQLTNLNKVN----SVGRVLYAMPVRI 54
Query: 81 QRS------FIDTTITIKISRHQNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGLQSSPG 134
S T+ + ++ DG+ F A + A +G S
Sbjct: 55 WSSATGNVASFLTSFSFEMKDI--KDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTK 112
Query: 135 DKFPPLAVELDTCLNKNLNDPDDNHIGIDINGIESNPVNSLLDVDLKSGRAIQVRIYYNP 194
+ VE DT N NDP +H+GID+N ++S + SG ++V + Y+
Sbjct: 113 GAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPW---NSVSGAVVKVTVIYDS 169
Query: 195 DFGQLSIYAAYSGETLVKVIEKPINLSDIIPTPVYVGFTAATG-DFLESHEVINWTFNS 252
LS+ + I + ++L +P V GF+A+ + H + +W+F S
Sbjct: 170 STKTLSVAVTNDN-GDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTS 227
|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 | Back alignment and structure |
|---|
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 | Back alignment and structure |
|---|
| >2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 | Back alignment and structure |
|---|
| >1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 113 | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 | Back alignment and structure |
|---|
| >2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Length = 226 | Back alignment and structure |
|---|
| >2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Length = 222 | Back alignment and structure |
|---|
| >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Length = 256 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| 3ujo_A | 281 | Legume lectin; carbohydrate-binding, galactose, ad | 100.0 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 100.0 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 100.0 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 100.0 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 100.0 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 100.0 | |
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 100.0 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 100.0 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 100.0 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 100.0 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 100.0 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 100.0 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 100.0 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 100.0 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 100.0 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 100.0 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 100.0 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 100.0 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 100.0 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 100.0 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 100.0 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 100.0 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 100.0 | |
| 2ltn_A | 181 | PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO | 100.0 | |
| 2dur_A | 253 | VIP36;, vesicular integral-membrane protein VIP36; | 100.0 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 100.0 | |
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 100.0 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 100.0 | |
| 2a6y_A | 256 | EMP47P (FORM1); beta sandwich, carbohydrate bindin | 99.97 | |
| 2a6z_A | 222 | EMP47P (FORM2); beta sandwich, carbohydrate bindin | 99.92 | |
| 1qmo_A | 113 | Mannose binding lectin, FRIL; crosslink, hematopoi | 99.88 | |
| 2a6v_A | 226 | EMP46P; beta sandwich, carbohydrate binding protei | 99.86 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 99.82 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 99.51 |
| >3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.4e-60 Score=426.41 Aligned_cols=232 Identities=27% Similarity=0.451 Sum_probs=193.1
Q ss_pred CchhhHHHHHhhcccccccCCCCceeEEcCCCCCCCCCccccccccCeEEecceEeCCCCC---CCCCCC------ceEE
Q 024380 1 MIFLLLLSVFLRGASSSILSEDTPISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGPP---PNLPIR------KVGR 71 (268)
Q Consensus 1 ~~~~~~~~~~l~~~~~~~~~~~~~~~F~f~~F~~~~~~~~~~~~~~~l~l~G~A~~~~~~i---T~~~~~------~~G~ 71 (268)
|..+++++|||..+.++ ..++|+|++|.. ++|+|+|+|.+. +|. |++..+ ++||
T Consensus 8 ~~~~~~fl~l~~~~~sa-----~~~sF~f~~F~~-----------~nL~l~GdA~i~-~g~L~LT~~~~~~~p~~~s~Gr 70 (281)
T 3ujo_A 8 MKRIVLFLILLTKAASA-----NLISFTFKKFNE-----------TNLILQRDATVS-SGKLRITKAAENGVPTAGSLGR 70 (281)
T ss_dssp ----------------C-----EEEEEEESSCCS-----------TTEEECSSCCCB-TTBEECSCCCSSCCCCSSCEEE
T ss_pred HHHHHHHHHHHcccCcC-----CcceEEcCCCCc-----------cCEEEecceEEe-CCEEEeCCCCCCCcccCCceEE
Confidence 34455677777766544 789999999985 789999999998 654 777654 9999
Q ss_pred EEeccceeccc------CCeEEEEEEEEeecccCCCCCCCceEEEEecCCCCCCCCCCCccccCCCC--CCCCCCcEEEE
Q 024380 72 VLYGKPLSLQR------SFIDTTITIKISRHQNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGLQSS--PGDKFPPLAVE 143 (268)
Q Consensus 72 ~~y~~Pi~l~~------~sFst~F~F~I~~~~~~~~~~gDGlAF~l~~~~~~~~~~~~Gg~lGl~~~--~~~~~~~vAVE 143 (268)
|+|++||++|| ++|+|+|+|.|.+ +....+||||||+|+|.+ ..| +..||||||+|. .+..++.||||
T Consensus 71 a~Y~~Pi~l~d~~tg~vaSFsTsFsF~I~~--~~~~~~gdGlAF~laP~~-~~p-~~~gg~LGL~n~~~~~~~n~~vAVE 146 (281)
T 3ujo_A 71 AFYSTPIQIWDNTTGTVASWATSFTFNLQA--PNAASPADGLAFALVPVG-SQP-KDKGGFLGLFDSKNYASSNQTVAVE 146 (281)
T ss_dssp EEESSCEECBCSSSCCBEEEEEEEEEECCC--SSTTSCCEEEEEEEEETT-CCC-CCCGGGTTTCSCSSCCTTSCCEEEE
T ss_pred EEECCCEEcccCCCCCceeEEEEEEEEEec--CCCCCCCCceEEEEecCC-CCC-CCCcceeeeccccCCCccCcEEEEE
Confidence 99999999998 6899999999998 666779999999999987 344 578999999986 34678999999
Q ss_pred EeccCc-CCCCCCCCCeeEEecCCCcccccccccccccCCCceEEEEEEEecCCcEEEEEEEecCCCceeEEEEeeeCCC
Q 024380 144 LDTCLN-KNLNDPDDNHIGIDINGIESNPVNSLLDVDLKSGRAIQVRIYYNPDFGQLSIYAAYSGETLVKVIEKPINLSD 222 (268)
Q Consensus 144 FDT~~N-~~~~Dp~~~HVgI~~ns~~s~~~~~~~~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~~~~~~~ls~~idL~~ 222 (268)
|||++| +| ||+++|||||+|++.|.++.+| ++.+|+.++|||+||+.+++|+|+|.+...+++|+++..+||++
T Consensus 147 FDT~~N~e~--Dp~~nHVGIDvNSi~S~~t~~~---~l~~G~~~~vwI~Yd~~tk~L~V~l~~~~~~~~~~lS~~vDL~~ 221 (281)
T 3ujo_A 147 FDTFYNGGW--DPTERHIGIDVNSIKSIKTTSW---DFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTS 221 (281)
T ss_dssp ECCSCCCSS--CCSSSEEEEEESSSCCSCEEEC---CCCSSCCEEEEEEECTTTCEEEEEEECTTTCCCEEEEEECCSTT
T ss_pred EeccccccC--CCCCCeEEEEcCCCCccccccc---cccCCCEEEEEEEEeCCCCEEEEEEecCCCCCCceEEEEechHH
Confidence 999999 99 9999999999999999988876 57899999999999999999999999865566899999999999
Q ss_pred CCCCceEEEEEeecCC---cccceEEEEEEEeeCCCCCC
Q 024380 223 IIPTPVYVGFTAATGD---FLESHEVINWTFNSFPVPPS 258 (268)
Q Consensus 223 ~l~~~~yvGFSAsTG~---~~~~h~I~sWsF~s~~~~~~ 258 (268)
+|+++|||||||+||. ..|.|+|++|+|++......
T Consensus 222 ~L~e~v~VGFSAsTG~~~~~~e~H~IlsWSFss~l~~~~ 260 (281)
T 3ujo_A 222 VLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINK 260 (281)
T ss_dssp TSCSEEEEEEEEEECSSTTSCCCCEEEEEEEEEEECSSS
T ss_pred hccCcEEEEEEeecCCCCcccceeEEEEEEEEEEcCCCC
Confidence 9999999999999996 68999999999999877654
|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... | Back alignment and structure |
|---|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* | Back alignment and structure |
|---|
| >2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A | Back alignment and structure |
|---|
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... | Back alignment and structure |
|---|
| >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 | Back alignment and structure |
|---|
| >2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A | Back alignment and structure |
|---|
| >1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 268 | ||||
| g1qmo.1 | 230 | b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich | 1e-46 | |
| d1hqla_ | 236 | b.29.1.1 (A:) Legume lectin {Griffonia simplicifol | 7e-45 | |
| d1leda_ | 243 | b.29.1.1 (A:) Legume lectin {West-central african | 3e-44 | |
| d1gzca_ | 239 | b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( | 4e-44 | |
| d1g9fa_ | 251 | b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) | 1e-43 | |
| d1v6ia_ | 232 | b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog | 2e-43 | |
| d1n47a_ | 233 | b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi | 2e-43 | |
| d1g8wa_ | 233 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 3e-43 | |
| d1fnya_ | 237 | b.29.1.1 (A:) Legume lectin {Black locust (Robinia | 2e-42 | |
| d1f9ka_ | 234 | b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca | 3e-41 | |
| d1ukga_ | 241 | b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero | 8e-41 | |
| d1qnwa_ | 237 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 8e-41 | |
| d2d3sa1 | 237 | b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso | 1e-40 | |
| d1fx5a_ | 240 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 1e-40 | |
| d1dbna_ | 239 | b.29.1.1 (A:) Legume lectin {Maackia amurensis, le | 2e-39 | |
| d1g7ya_ | 253 | b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos | 7e-39 | |
| g2ltn.1 | 229 | b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum | 3e-38 | |
| d1avba_ | 226 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 1e-37 | |
| d1ioaa_ | 228 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 4e-36 | |
| d1nlsa_ | 237 | b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia | 3e-31 | |
| d1nlsa_ | 237 | b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia | 4e-10 | |
| d1dhkb_ | 204 | b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar | 3e-31 | |
| d1gv9a_ | 228 | b.29.1.13 (A:) Carbohydrate-recognition domain of | 4e-22 | |
| d2a6za1 | 221 | b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake | 3e-14 | |
| d2a6va1 | 218 | b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake | 2e-13 |
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 | Back information, alignment and structure |
|---|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 | Back information, alignment and structure |
|---|
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| d1hqla_ | 236 | Legume lectin {Griffonia simplicifolia, lectin I-b | 100.0 | |
| d1g9fa_ | 251 | Legume lectin {Soybean (Glycine max) [TaxId: 3847] | 100.0 | |
| d1leda_ | 243 | Legume lectin {West-central african legume (Griffo | 100.0 | |
| d1gzca_ | 239 | Legume lectin {Cockspur coral tree (Erythrina cris | 100.0 | |
| d1fx5a_ | 240 | Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI | 100.0 | |
| d1qnwa_ | 237 | Legume lectin {Furze (Ulex europaeus), UEA-II [Tax | 100.0 | |
| d2d3sa1 | 237 | Legume lectin {Winged bean (Psophocarpus tetragono | 100.0 | |
| d1n47a_ | 233 | Legume lectin {Hairy vetch (Vicia villosa), isolec | 100.0 | |
| d1g8wa_ | 233 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 100.0 | |
| d1dbna_ | 239 | Legume lectin {Maackia amurensis, leukoagglutinin | 100.0 | |
| d1f9ka_ | 234 | Legume lectin {Winged bean (Psophocarpus tetragono | 100.0 | |
| d1g7ya_ | 253 | Legume lectin {Horse gram (Dolichos biflorus), dif | 100.0 | |
| d1fnya_ | 237 | Legume lectin {Black locust (Robinia pseudoacacia) | 100.0 | |
| g1qmo.1 | 230 | Legume lectin {Field bean (Dolichos lablab), Fril | 100.0 | |
| d1v6ia_ | 232 | Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 | 100.0 | |
| g2ltn.1 | 229 | Legume lectin {Garden pea (Pisum sativum) [TaxId: | 100.0 | |
| d1ukga_ | 241 | Legume lectin {Bloodwood tree (Pterocarpus angolen | 100.0 | |
| d1ioaa_ | 228 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 100.0 | |
| d1avba_ | 226 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 100.0 | |
| d1dhkb_ | 204 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 100.0 | |
| d1gv9a_ | 228 | Carbohydrate-recognition domain of P58/ERGIC-53 {R | 100.0 | |
| d1nlsa_ | 237 | Concanavalin A {Jack bean (Canavalia ensiformis) [ | 99.98 | |
| d2a6za1 | 221 | Emp47p N-terminal domain {Baker's yeast (Saccharom | 99.94 | |
| d2a6va1 | 218 | Emp46p N-terminal domain {Baker's yeast (Saccharom | 99.94 | |
| d1nlsa_ | 237 | Concanavalin A {Jack bean (Canavalia ensiformis) [ | 99.84 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 86.05 |
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Legume lectins domain: Legume lectin species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]
Probab=100.00 E-value=8.9e-56 Score=389.14 Aligned_cols=216 Identities=29% Similarity=0.464 Sum_probs=188.1
Q ss_pred ceeEEcCCCCCCCCCccccccccCeEEecceEeCCCCC--CCC------CCCceEEEEeccceeccc------CCeEEEE
Q 024380 24 PISFSFPSFAKDSCDNKTLICYGAIESSGALSITPGPP--PNL------PIRKVGRVLYGKPLSLQR------SFIDTTI 89 (268)
Q Consensus 24 ~~~F~f~~F~~~~~~~~~~~~~~~l~l~G~A~~~~~~i--T~~------~~~~~G~~~y~~Pi~l~~------~sFst~F 89 (268)
+++|+|++|..+.. .+|.|+|+|.+..+.+ |+. .+.++|||+|++||++|+ ++|+|+|
T Consensus 1 ~~sF~f~~F~~~~~--------~~l~l~G~A~~~~~~l~LT~~~~~~~~~~~s~Gra~y~~Pv~l~~~~t~~~asFsT~F 72 (236)
T d1hqla_ 1 SVSFTFPNFWSDVE--------DSIIFQGDANTTAGTLQLCKTNQYGTPLQWSAGRALYSDPVQLWDNKTESVASFYTEF 72 (236)
T ss_dssp CCEEEESCSCSCGG--------GTEEEEETCEEETTEEECSCBCTTSCBCSSCEEEEEESSCEECCCSTTCCCCEEEEEE
T ss_pred CEEEEeCCCCCCCc--------CCEEEeccEEecCCEEEEecCCCCCcccccceEEEEECCCEEeecCCCCceeEEEEEE
Confidence 47999999987542 6899999999976555 553 367899999999999998 7899999
Q ss_pred EEEEeecccCCCCCCCceEEEEecCCCCCCCCCCCccccCCCC----CCCCCCcEEEEEeccCc-CCCCCCCCCeeEEec
Q 024380 90 TIKISRHQNYTDRAGDGMTFIFASDKNGPSAKGVGEYLGLQSS----PGDKFPPLAVELDTCLN-KNLNDPDDNHIGIDI 164 (268)
Q Consensus 90 ~F~I~~~~~~~~~~gDGlAF~l~~~~~~~~~~~~Gg~lGl~~~----~~~~~~~vAVEFDT~~N-~~~~Dp~~~HVgI~~ 164 (268)
+|+|.. . ...+||||||+|+|.. .+.+..|++||+++. +...++.+|||||||+| ++ +||+.+||||++
T Consensus 73 ~F~i~~--~-~~~~gDGlAFvl~p~~--~~~~~~G~~lGl~~~~~~~~~~~~~~vAVEFDT~~n~~~-~D~~~nHIgIdv 146 (236)
T d1hqla_ 73 TFFLKI--T-GNGPADGLAFFLAPPD--SDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNF-PEPSYRHIGINV 146 (236)
T ss_dssp EEEEEE--C-SSCCCCEEEEEEECTT--CCCCCCGGGTTTSCTTTTTCGGGCCCEEEEEECSCCSSS-CCCSSCEEEEEE
T ss_pred EEEEeC--C-CCCCCceEEEEEeCCC--CCCCCCccccccccccccCCcccCceEEEEeeCccCCCC-CCCCCCEEEEEc
Confidence 999987 4 5678999999999976 344678999999876 12357899999999999 76 799999999999
Q ss_pred CCCcccccccccccccCCCceEEEEEEEecCCcEEEEEEEecCCCceeEEEEeeeCCCCCCCceEEEEEeecCCc-ccce
Q 024380 165 NGIESNPVNSLLDVDLKSGRAIQVRIYYNPDFGQLSIYAAYSGETLVKVIEKPINLSDIIPTPVYVGFTAATGDF-LESH 243 (268)
Q Consensus 165 ns~~s~~~~~~~~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~~~~~~~ls~~idL~~~l~~~~yvGFSAsTG~~-~~~h 243 (268)
|++.+..+.++...+|++|+.++|||+||+.+++|+|+|++. ++.+|+|++.+||+++|+++||||||||||+. .+.|
T Consensus 147 ns~~s~~~~~~~~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~-~~~~~~ls~~vdL~~~l~~~v~vGFSasTG~~~~~~h 225 (236)
T d1hqla_ 147 NSIVSVATKRWEDSDIFSGKIATARISYDGSAEILTVVLSYP-DGSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTV 225 (236)
T ss_dssp SSSSCSEEEECCHHHHTSCSCEEEEEEEETTTTEEEEEEEET-TTEEEEEEEECCGGGTSCSEEEEEEEEECCSCCCEEE
T ss_pred CCcccccccccccccccCCCEEEEEEEEeCCCcEEEEEEecC-CCCCeeEEEEeCHHHhCCCcEEEEEEeECCCCCceEE
Confidence 999998888776678999999999999999999999999874 57789999999999999999999999999975 6789
Q ss_pred EEEEEEEeeCC
Q 024380 244 EVINWTFNSFP 254 (268)
Q Consensus 244 ~I~sWsF~s~~ 254 (268)
+|++|+|++.+
T Consensus 226 ~I~sWsF~s~l 236 (236)
T d1hqla_ 226 YILSWRFSSNL 236 (236)
T ss_dssp EEEEEEEEEEC
T ss_pred EEEEeEeEecC
Confidence 99999999853
|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|