Citrus Sinensis ID: 024416
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 268 | ||||||
| 224133834 | 266 | predicted protein [Populus trichocarpa] | 0.992 | 1.0 | 0.716 | 1e-113 | |
| 359491160 | 254 | PREDICTED: uncharacterized protein LOC10 | 0.940 | 0.992 | 0.734 | 1e-111 | |
| 297733623 | 276 | unnamed protein product [Vitis vinifera] | 0.914 | 0.887 | 0.760 | 1e-111 | |
| 296081316 | 409 | unnamed protein product [Vitis vinifera] | 1.0 | 0.655 | 0.641 | 1e-102 | |
| 359488643 | 279 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.960 | 0.641 | 1e-101 | |
| 226531528 | 276 | uncharacterized protein LOC100275449 pre | 0.888 | 0.862 | 0.705 | 1e-100 | |
| 242083250 | 276 | hypothetical protein SORBIDRAFT_08g00828 | 0.947 | 0.920 | 0.678 | 1e-100 | |
| 238013592 | 275 | unknown [Zea mays] gi|413916779|gb|AFW56 | 0.884 | 0.861 | 0.705 | 1e-99 | |
| 449440588 | 280 | PREDICTED: uncharacterized protein LOC10 | 0.906 | 0.867 | 0.680 | 1e-98 | |
| 218186624 | 330 | hypothetical protein OsI_37889 [Oryza sa | 0.996 | 0.809 | 0.643 | 4e-98 |
| >gi|224133834|ref|XP_002321672.1| predicted protein [Populus trichocarpa] gi|222868668|gb|EEF05799.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 414 bits (1065), Expect = e-113, Method: Compositional matrix adjust.
Identities = 192/268 (71%), Positives = 227/268 (84%), Gaps = 2/268 (0%)
Query: 1 MGRNTQIFTSIFLLLLFSPQEILIQGFDDSASRTLKQEPGRAHEVHCSRERSRAAWGVIE 60
MG+ +I +FL+ L S Q + + A+RT+KQE G AH+VHCSRERSRAAW IE
Sbjct: 1 MGKAARITQILFLISLLSKQILSQDVGEHVAARTVKQEEGHAHKVHCSRERSRAAWQAIE 60
Query: 61 EYLMPFVEQVQYEISSKCRLHPDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQH 120
EYLMPFVE+ QY+ISSKCRLHP ND+FRDQE+HKIHVDINEW+CGYCKK FRAEK+LDQH
Sbjct: 61 EYLMPFVEREQYQISSKCRLHPSNDLFRDQEEHKIHVDINEWKCGYCKKHFRAEKYLDQH 120
Query: 121 FDNRHNNLLNVSHGKCLADLCGALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFP 180
FDNRH NLLN+S GKC+ADLCGALHCDF+M+SKS+++KCNPAAVAKN HLCESLA+ CFP
Sbjct: 121 FDNRHYNLLNISDGKCMADLCGALHCDFMMDSKSTKTKCNPAAVAKNHHLCESLADSCFP 180
Query: 181 INQGPSASRLHELFLRQFCDAHKCPRKSQPFPKGGRKQPSVFYLSISILTLMLLPIFYLI 240
+NQGPSASRLHELFL QFCDAH C + FPKGG+K+ SVFYL+ISILT+M++P+FYLI
Sbjct: 181 LNQGPSASRLHELFLHQFCDAHTCSGNKKLFPKGGKKKTSVFYLAISILTMMMIPLFYLI 240
Query: 241 VYLYQREMRGGTQELKRIPRVGRKAKPS 268
VYL+Q EMR GTQEL+RI + RK KPS
Sbjct: 241 VYLHQSEMRKGTQELRRISK--RKTKPS 266
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359491160|ref|XP_002262859.2| PREDICTED: uncharacterized protein LOC100244377 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297733623|emb|CBI14870.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296081316|emb|CBI17698.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359488643|ref|XP_002271064.2| PREDICTED: uncharacterized protein LOC100257742 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|226531528|ref|NP_001142988.1| uncharacterized protein LOC100275449 precursor [Zea mays] gi|195612594|gb|ACG28127.1| zinc finger protein [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242083250|ref|XP_002442050.1| hypothetical protein SORBIDRAFT_08g008280 [Sorghum bicolor] gi|241942743|gb|EES15888.1| hypothetical protein SORBIDRAFT_08g008280 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|238013592|gb|ACR37831.1| unknown [Zea mays] gi|413916779|gb|AFW56711.1| zinc finger protein [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|449440588|ref|XP_004138066.1| PREDICTED: uncharacterized protein LOC101218367 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|218186624|gb|EEC69051.1| hypothetical protein OsI_37889 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 268 | ||||||
| TAIR|locus:2162012 | 271 | AT5G63280 "AT5G63280" [Arabido | 0.910 | 0.900 | 0.680 | 1.6e-95 | |
| TAIR|locus:2168783 | 272 | AT5G40710 "AT5G40710" [Arabido | 0.835 | 0.823 | 0.604 | 3.3e-79 | |
| FB|FBgn0031257 | 667 | CG4133 [Drosophila melanogaste | 0.447 | 0.179 | 0.322 | 4.3e-19 | |
| CGD|CAL0005892 | 132 | orf19.4195 [Candida albicans ( | 0.25 | 0.507 | 0.373 | 7.1e-07 | |
| UNIPROTKB|Q59NH5 | 132 | CaO19.4195 "Potential zinc fin | 0.25 | 0.507 | 0.373 | 7.1e-07 |
| TAIR|locus:2162012 AT5G63280 "AT5G63280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 950 (339.5 bits), Expect = 1.6e-95, P = 1.6e-95
Identities = 168/247 (68%), Positives = 202/247 (81%)
Query: 25 QGFDDSASRTLKQEP---GRAHEVHCSRERSRAAWGVIEEYLMPFVEQVQYEISSKCRLH 81
QGF++S S L E A E+HCSRERSRAAW +I++YL PFVE+ +YEI CRLH
Sbjct: 25 QGFEESESTRLVNEEVEVSNAPEIHCSRERSRAAWQIIQDYLTPFVERERYEIPKNCRLH 84
Query: 82 PDNDMFRDQEQHKIHVDINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVSHGKCLADLC 141
PDND++RDQE HK+HVD+ EW+CGYCKKSF EKFLD+HF RH NLLN + KCLADLC
Sbjct: 85 PDNDLYRDQEHHKVHVDVFEWKCGYCKKSFNDEKFLDKHFSTRHYNLLNTTDTKCLADLC 144
Query: 142 GALHCDFVMNSKSSRSKCNPAAVAKNRHLCESLANRCFPINQGPSASRLHELFLRQFCDA 201
GALHCDFV++SK +SKCNP AVAKNRHLCES+AN CFP++QGPSASRLHE FLRQFCDA
Sbjct: 145 GALHCDFVLSSKKPKSKCNPPAVAKNRHLCESVANSCFPVSQGPSASRLHEHFLRQFCDA 204
Query: 202 HKCPRKSQPFPKGGRKQPSVFYLSISILTLMLLPIFYLIVYLYQREMRGGTQELKRIPRV 261
H C +PFP+GG+K+ VFYL+ISILTLMLLP+FYL+V+L+QRE R GTQ+L+RI +
Sbjct: 205 HTCTGNDKPFPRGGKKKSGVFYLAISILTLMLLPLFYLLVFLHQREKRSGTQDLRRIIKS 264
Query: 262 GRKAKPS 268
G+K KPS
Sbjct: 265 GKKTKPS 271
|
|
| TAIR|locus:2168783 AT5G40710 "AT5G40710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031257 CG4133 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0005892 orf19.4195 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59NH5 CaO19.4195 "Potential zinc finger protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_XV000644 | hypothetical protein (266 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| KOG4173 | 253 | consensus Alpha-SNAP protein [Intracellular traffi | 98.32 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.79 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 96.76 | |
| PF04959 | 214 | ARS2: Arsenite-resistance protein 2; InterPro: IPR | 95.35 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 94.66 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 94.55 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 94.21 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 92.99 | |
| PHA00616 | 44 | hypothetical protein | 92.28 | |
| PHA00733 | 128 | hypothetical protein | 92.15 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 90.66 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 89.23 | |
| PHA00732 | 79 | hypothetical protein | 82.48 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 81.72 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 80.75 |
| >KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=98.32 E-value=7.8e-08 Score=87.40 Aligned_cols=69 Identities=23% Similarity=0.575 Sum_probs=60.9
Q ss_pred CCCCCCCCCCccccchhhhhhhh-cCcccccccccccCCchhhHhhhhhccccccccCC--cc----Cchhhhccc
Q 024416 75 SSKCRLHPDNDMFRDQEQHKIHV-DINEWRCGYCKKSFRAEKFLDQHFDNRHNNLLNVS--HG----KCLADLCGA 143 (268)
Q Consensus 75 ~~~C~L~P~~D~F~~~E~~k~h~-~~h~wrC~~CgK~F~sE~~LDlHidnrH~~ll~~~--~~----~CLaD~Cd~ 143 (268)
...|+.--.-.+|-.-+.|+.|| ..|.+-|.+|+|.|||.+.||.||-|-|+++.+.. |+ .||+|+|..
T Consensus 79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~ 154 (253)
T KOG4173|consen 79 AFACQVAGCCQVFDALDDYEHHYHTLHGNSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE 154 (253)
T ss_pred cccccccchHHHHhhhhhHHHhhhhcccchhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence 34588777778999999999999 88999999999999999999999999999987764 43 899999974
|
|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 268 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 43.7 bits (102), Expect = 4e-05
Identities = 34/214 (15%), Positives = 59/214 (27%), Gaps = 55/214 (25%)
Query: 12 FLLLLFSPQE---ILIQGFDDSASR----TLKQEPGRAHEVHC-SRERSRAAW---GVIE 60
+ S +E I++ S + TL + + R + +
Sbjct: 41 MPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKT 100
Query: 61 EYLMPFVEQVQYEISSKCRLHPDNDMF------RDQEQHKIHVDINEWR----------- 103
E P + Y I + RL+ DN +F R Q K+ + E R
Sbjct: 101 EQRQPSMMTRMY-IEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVL 159
Query: 104 -CGYCKKS------FRAEKFLDQHFDNRHNNLLNVSHGKC---------LADLCGALHCD 147
G K+ + K + LN+ C L L + +
Sbjct: 160 GSG---KTWVALDVCLSYKVQCKMDFKIF--WLNL--KNCNSPETVLEMLQKLLYQIDPN 212
Query: 148 FVMNSKSS---RSKCNPAAVAKNRHLCESLANRC 178
+ S S + + + R L C
Sbjct: 213 WTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENC 246
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 96.86 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 96.83 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 96.69 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 96.65 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 96.5 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 96.32 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 96.27 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 96.13 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 96.13 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 96.13 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 96.05 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 96.04 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 96.03 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 96.0 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 95.97 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 95.92 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 95.9 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 95.9 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 95.89 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 95.76 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 95.73 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 95.65 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 95.6 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 95.6 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 95.55 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 95.54 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 95.48 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 95.48 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 95.46 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 95.4 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 95.39 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 95.35 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 95.35 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 95.35 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 95.32 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 95.29 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.22 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 95.18 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 95.17 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 95.17 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 95.15 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 95.13 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 95.11 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 95.02 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 94.94 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.93 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 94.93 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 94.93 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 94.91 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.9 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 94.89 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 94.89 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.84 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 94.82 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 94.73 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 94.73 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 94.72 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 93.69 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.65 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 94.59 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 94.55 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.54 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 94.52 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.52 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 94.51 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.51 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 94.5 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 94.5 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.49 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 94.49 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 94.49 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.48 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.47 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 94.46 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.44 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.44 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 94.44 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.41 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.41 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.4 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.39 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 94.37 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.37 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 94.35 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.35 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 93.38 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 94.29 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.28 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 94.25 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.25 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.23 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.23 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 94.22 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.26 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 94.21 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 94.19 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 94.19 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 94.17 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.16 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 94.15 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.15 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.14 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.13 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.13 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 94.12 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.1 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 94.1 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.1 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 94.09 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.08 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.07 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 94.06 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.06 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 94.06 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 94.03 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 94.02 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 94.01 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.01 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.01 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 94.0 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 93.98 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.98 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 93.98 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 93.96 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.94 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 93.94 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 93.94 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 93.94 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.88 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 93.85 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.84 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.82 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.82 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 93.81 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 93.81 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 93.8 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.79 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.78 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.78 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.77 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.77 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.77 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 93.71 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.7 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.69 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.69 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.67 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 93.67 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 93.67 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.66 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 93.62 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 93.62 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 93.61 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 93.6 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.56 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 93.55 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 93.54 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.51 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 93.5 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.5 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 93.48 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 93.46 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.42 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.33 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 93.33 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 93.3 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 93.3 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 93.29 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.29 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 93.27 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.22 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 93.2 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 93.12 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.12 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 93.11 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.05 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.95 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.92 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.86 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 92.86 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.84 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 92.76 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 92.69 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 92.66 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 92.47 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 92.46 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 92.44 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 92.42 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 92.37 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 92.33 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 92.32 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 92.18 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 92.17 | |
| 2ab3_A | 29 | ZNF29; zinc finger protein, beta BETA alpha, RREII | 92.04 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 91.95 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 91.3 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 91.08 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 91.05 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 90.71 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 90.37 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 90.2 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 90.19 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 89.85 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 89.74 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 89.62 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 89.52 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 88.86 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 88.47 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 88.18 | |
| 1va1_A | 37 | Transcription factor SP1; C2H2 type zinc finger, D | 87.44 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 87.11 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.88 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 86.0 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 85.99 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 85.59 | |
| 2elu_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 84.72 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 83.41 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 83.11 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 82.51 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 81.59 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 81.4 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 80.94 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 80.58 | |
| 3ax1_A | 358 | Serrate RNA effector molecule; miRNA processing, p | 80.5 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 80.18 |
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
Probab=96.86 E-value=0.00089 Score=44.46 Aligned_cols=51 Identities=25% Similarity=0.516 Sum_probs=41.0
Q ss_pred CCCCCCCCCccccchhhhhhhhcCc----ccccccccccCCchhhHhhhhhcccccc
Q 024416 76 SKCRLHPDNDMFRDQEQHKIHVDIN----EWRCGYCKKSFRAEKFLDQHFDNRHNNL 128 (268)
Q Consensus 76 ~~C~L~P~~D~F~~~E~~k~h~~~h----~wrC~~CgK~F~sE~~LDlHidnrH~~l 128 (268)
-.|+.- ...|.....++.|...| .+.|..|+|.|.+...|..|+...|..-
T Consensus 3 ~~C~~C--~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~ 57 (60)
T 2adr_A 3 FVCEVC--TRAFARQEHLKRHYRSHTNEKPYPCGLCNRAFTRRDLLIRHAQKIHSGN 57 (60)
T ss_dssp BCCTTT--CCCBSCHHHHHHHHHTTTSSCSEECTTTCCEESSHHHHHHHHTTTSCCS
T ss_pred CcCCCC--ccccCCHHHHHHHHHHhCCCCCccCCCCCCccCCHHHHHHHHHHHcCCc
Confidence 356543 35799999999888555 4789999999999999999998888753
|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ax1_A Serrate RNA effector molecule; miRNA processing, protein binding; 2.74A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 268 | |||
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 94.78 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 94.53 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 94.27 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 94.25 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 94.14 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 94.07 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 93.97 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 93.95 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 93.02 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 92.98 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 92.25 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 90.75 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 89.96 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 89.25 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 89.0 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 88.52 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 88.08 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 86.79 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 86.3 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 84.85 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 84.84 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 84.74 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 84.7 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 84.32 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 83.77 | |
| d2dlka1 | 30 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 83.22 | |
| d1zr9a1 | 67 | Zinc finger protein 593, ZNF593 {Human (Homo sapie | 82.24 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 80.05 |
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: PATZ1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=94.78 E-value=0.0041 Score=40.03 Aligned_cols=27 Identities=26% Similarity=0.602 Sum_probs=24.2
Q ss_pred ccccccccccCCchhhHhhhhhccccc
Q 024416 101 EWRCGYCKKSFRAEKFLDQHFDNRHNN 127 (268)
Q Consensus 101 ~wrC~~CgK~F~sE~~LDlHidnrH~~ 127 (268)
-+.|.+|||.|.....|..||..-|..
T Consensus 5 py~C~~Cgk~F~~~~~L~~H~r~~Ht~ 31 (39)
T d2epsa1 5 PYICQSCGKGFSRPDHLNGHIKQVHTS 31 (39)
T ss_dssp CEECSSSCCEESSHHHHHHHHHHTSCC
T ss_pred CccCCCCCCCcCChHHhhccCcCccCC
Confidence 478999999999999999999887764
|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|