Citrus Sinensis ID: 024440

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MACPSLLHSSASSFHGRFPALSSSSYVRPTYPNPINVNGVVSVKAAAGGIVLVEKSEAEKTGRLKTTYLEKIVPLLREEFSYTNIHQVPKIEKIVVNCGIGDAAQNAKGLEAAMNDLALITGQRPVKTRARNSIATFKIREGEPLGIAVTLRGNMMYSFLDRLINLGLPRTRDFQGVNPNSFDGHGNYSIGVKEQSVFPEIRYDALGKPKGIDVCITTTAKTDKEGQRLLALMGMPFREGGGPANLIRKKKLKAHHFDSKSKGKSRR
cccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccEEEEEEcccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHHHHcccccccccccccHHHHHHHHHccccccccccccc
**********A**FHGRFP******YVRPTYPNPINVNGVVSVKAAAGGIVLVEKSEAEKTGRLKTTYLEKIVPLLREEFSYTNIHQVPKIEKIVVNCGIGDAAQNAKGLEAAMNDLALITGQRPVKTRARNSIATFKIREGEPLGIAVTLRGNMMYSFLDRLINLGLPRTRDFQGVNPNSFDGHGNYSIGVKEQSVFPEIRYDALGKPKGIDVCITTTAKTDKEGQRLLALMGMPF******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACPSLLHSSASSFHGRFPALSSSSYVRPTYPNPINVNGVVSVKAAAGGIVLVEKSEAEKTGRLKTTYLEKIVPLLREEFSYTNIHQVPKIEKIVVNCGIGDAAQNAKGLEAAMNDLALITGQRPVKTRARNSIATFKIREGEPLGIAVTLRGNMMYSFLDRLINLGLPRTRDFQGVNPNSFDGHGNYSIGVKEQSVFPEIRYDALGKPKGIDVCITTTAKTDKEGQRLLALMGMPFREGGGPANLIRKKKLKAHHFDSKSKGKSRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L5, chloroplastic Binds 5S rRNA, forms part of the central protuberance of the 50S subunit.confidentO04603
50S ribosomal protein L5, chloroplastic Binds 5S rRNA, forms part of the central protuberance of the 50S subunit.probableP82192
50S ribosomal protein L5 This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.probableQ927L9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain H
Confidence level:very confident
Coverage over the Query: 63-237
View the alignment between query and template
View the model in PyMOL