Citrus Sinensis ID: 024450

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------

MDFHTKPSSLSLILFTTLVIFVHAKTDSDITNLVYRGCAEQKFPNPSEVYTQNLNTLLSSLVSRSSQETFNTTTSGDEQTSITGLYQCRGDLTTPECYTCVSKIPDLAYKLCSKAVAARVQLSGCYLKYEVIGFSQVPETELLYKICGSTQVTGAAVFEQRRNTAFNMVTNGVKNSVELFYTGTYEHVYILGECEGDIASGNCGDCVKTATERAKNECDDSISAQIYLNKCFISYSYYPNGVPNPNSSLSSGAQGSIHRRQWQWQLE

ccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccCEECcccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccEEEEEccEEEEECccccECcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccEEEccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEcccEEEEEEEcccccccccccccccccccccccccccccc

*********LSLILFTTLVIFVHAKTDSDITNLVYRGCAEQKFPNPSEVYTQNLNTLLSSLVSRSSQETFNTTTSGDEQTSITGLYQCRGDLTTPECYTCVSKIPDLAYKLCSKAVAARVQLSGCYLKYEVIGFSQVPETELLYKICGSTQVTGAAVFEQRRNTAFNMVTNGVKNSVELFYTGTYEHVYILGECEGDIASGNCGDCVKTATERAKNECDDSISAQIYLNKCFISYSYYPNG**************************

xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cysteine-rich repeat secretory protein 3		probable	Q6NM73

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A2E, chain A
Confidence level:very confident
Coverage over the Query: 30-134
View the alignment between query and template
View the model in PyMOL

Template: 3A2E, chain A
Confidence level:confident
Coverage over the Query: 140-240
View the alignment between query and template
View the model in PyMOL