Citrus Sinensis ID: 024451

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTADVLSVSISGSNSRMFVSGSCDSTARLWDTRVASRAVRTFHGHEGDVNTVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYYQQHGENEIPHVTSIAFSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL
cEEEECccccEEEEccccccEEEEEcccccccccccccccccccccccEEEEEECcccccEEEEccccccEEEEEcccccEEEEccccccccccccEEEEEEccccccEEEEccccccEEEEEcccccccccccccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEEccccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEcccccccccccEEEEEEcccccCEEEccccccEEEEEcccccccc
MTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTADVLSVSISGSNSRMFVSGSCDSTARLWDTRVASRAVRTFHGHEGDVNTVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYYQQHGENEIPHVTSIAFSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTCAFSPTGQSVACGGLDSVCSIFNLNSPTDKDGNLPVSRMLSGHKGYVSCCQYVPDEDTHLITSSGDQTCVLWDITTGLRTSVFGGEFQSGHTADVLSVSISGSNSRMFVSGSCDSTARLWDTRVASRAVRTFHGHEGDVNTVKFFPDGNRFGTGSDDGTCRLFDIRTGHQLQVYYQQHGENEIPHVTSIAFSISGRLLFAGYSNGDCYVWDTLLAKVVLNLGSLQNSHEGRITCLGLSADGSALCTGSWDTNLKIWAFGGYRRVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Guanine nucleotide-binding protein subunit beta Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.probableP93563
Guanine nucleotide-binding protein subunit beta Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Together with GCR1 and GPA1, acts as a negative regulator of ABA during seed germination and early seedling development.probableP49177
Guanine nucleotide-binding protein subunit beta Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.probableQ40687

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain a
Confidence level:very confident
Coverage over the Query: 1-267
View the alignment between query and template
View the model in PyMOL