Citrus Sinensis ID: 024473


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MGTISCTNTVSLNGACTRFFAADSLSSKASSVFFNNRTWKLKLRPLVASSSSSSMATNFQVTASSSIGAVKEEQKGASSGGVGENDLLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISLCYLVEKFQGLPLLLKSPGIFSANWHYICVKLNY
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHcccccccccccccccccEEEEEccccccccHHHHHHHHHHHHcccccEEEEEccEEEEcccccEEccccccccccccHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHcccccccccccccccccEEEEEccc
cccEcccccccccccEEEEcccccccccccccEcccccEcccccccccccccHHcccccEEcHHHcccccHHHcccccccccccccEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHcccccccccccccccccEEEEEcccccccccHHHHHHHHHHcccccEEEEEEccccEccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHccccccEEcccEEEEEEccc
mgtisctntvslnGACTRFfaadslsskassvffnnrtwklklrplvassssssmatNFQVTasssigavkeeqkgassggvgendllivgpGVLGRLVAEQWRqehpgcqiygqtmtadhhdelinmgitpslkwteatqkfpyvifcappsrsldypgdVRLAALswngegsflftsssaiydcsdngacdedspvvpigrsprtdVLLKAEKVILEFGGCVLRLAGLYISLCYLVEkfqglplllkspgifsanWHYICVKLNY
mgtisctntvslNGACTRFFAADSLSSKASSVFFNNRTWKLKLRPLVassssssmaTNFQVTASSSIGAVKEEQkgassggvgendlLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISLCYLVEKFQGLPLLLKspgifsanwHYICVKLNY
MGTISCTNTVSLNGACTRFFAADSLSSKASSVFFNNRTWKLKLRPLVAssssssMATNFQVTASSSIGAVKEEQKGASSGGVGENDLLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISLCYLVEKFQGLPLLLKSPGIFSANWHYICVKLNY
*****CTNTVSLNGACTRFFAADSLSSKASSVFFNNRTWKLKLRPL**************************************NDLLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISLCYLVEKFQGLPLLLKSPGIFSANWHYICVKL**
*******NTVSLNGACTRFFA*****************************************************************LLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTAD*H*ELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISLCYLVEKFQGLPLLLKSPGIFSANWHYICVKLNY
MGTISCTNTVSLNGACTRFFAADSLSSKASSVFFNNRTWKLKLRPL*********ATNFQVTASSSIGAVK*********GVGENDLLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISLCYLVEKFQGLPLLLKSPGIFSANWHYICVKLNY
***ISCTNTVSLNGACTRFFAADS*SS*ASSVFFNNRTWKLKLR*********************SIGAVKEEQKGASSGGVGENDLLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISLCYLVEKFQGLPLLLKSPGIFSANWHYICVKLNY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTISCTNTVSLNGACTRFFAADSLSSKASSVFFNNRTWKLKLRPLVASSSSSSMATNFQVTASSSIGAVKEEQKGASSGGVGENDLLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISLCYLVEKFQGLPLLLKSPGIFSANWHYICVKLNY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
224100351304 predicted protein [Populus trichocarpa] 0.685 0.601 0.792 2e-80
297736912 410 unnamed protein product [Vitis vinifera] 0.722 0.470 0.725 5e-78
225432384343 PREDICTED: uncharacterized protein LOC10 0.700 0.545 0.732 4e-77
449466191341 PREDICTED: uncharacterized protein LOC10 0.835 0.653 0.598 1e-75
255551645287 conserved hypothetical protein [Ricinus 0.644 0.599 0.784 7e-75
356512227353 PREDICTED: uncharacterized protein LOC10 0.797 0.603 0.618 1e-70
356524994353 PREDICTED: uncharacterized protein LOC10 0.797 0.603 0.614 5e-69
297827493344 hypothetical protein ARALYDRAFT_903150 [ 0.850 0.659 0.613 8e-69
147774573297 hypothetical protein VITISV_001889 [Viti 0.681 0.612 0.675 1e-67
51970960351 unnamed protein product [Arabidopsis tha 0.677 0.515 0.712 1e-67
>gi|224100351|ref|XP_002311843.1| predicted protein [Populus trichocarpa] gi|222851663|gb|EEE89210.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 159/183 (86%)

Query: 55  MATNFQVTASSSIGAVKEEQKGASSGGVGENDLLIVGPGVLGRLVAEQWRQEHPGCQIYG 114
           MA   QV+A S+IGA  EE   ASSG VGENDLLIVGPGVLGRLVAE+WRQEHPGCQ+YG
Sbjct: 1   MAAPLQVSAFSTIGARNEELGTASSGLVGENDLLIVGPGVLGRLVAEKWRQEHPGCQVYG 60

Query: 115 QTMTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGS 174
           QT+T DHHDELI MGI PSLK T+ATQ++PYVIFCAPPSR+ DYPGDVR AALSWNG+GS
Sbjct: 61  QTVTTDHHDELIKMGINPSLKGTKATQQYPYVIFCAPPSRTSDYPGDVREAALSWNGDGS 120

Query: 175 FLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYISL 234
           F+FTSSSA YDC DNG C+EDSPVVPIGRSPRTDVLLKAEKV+LE GGC +RLAGLYIS 
Sbjct: 121 FVFTSSSAPYDCFDNGQCNEDSPVVPIGRSPRTDVLLKAEKVVLESGGCAIRLAGLYISF 180

Query: 235 CYL 237
             L
Sbjct: 181 SVL 183




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297736912|emb|CBI26113.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225432384|ref|XP_002276706.1| PREDICTED: uncharacterized protein LOC100251108 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449466191|ref|XP_004150810.1| PREDICTED: uncharacterized protein LOC101221257 [Cucumis sativus] gi|449496699|ref|XP_004160201.1| PREDICTED: uncharacterized protein LOC101225299 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255551645|ref|XP_002516868.1| conserved hypothetical protein [Ricinus communis] gi|223543956|gb|EEF45482.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356512227|ref|XP_003524822.1| PREDICTED: uncharacterized protein LOC100804718 [Glycine max] Back     alignment and taxonomy information
>gi|356524994|ref|XP_003531112.1| PREDICTED: uncharacterized protein LOC100776260 [Glycine max] Back     alignment and taxonomy information
>gi|297827493|ref|XP_002881629.1| hypothetical protein ARALYDRAFT_903150 [Arabidopsis lyrata subsp. lyrata] gi|297327468|gb|EFH57888.1| hypothetical protein ARALYDRAFT_903150 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147774573|emb|CAN63394.1| hypothetical protein VITISV_001889 [Vitis vinifera] Back     alignment and taxonomy information
>gi|51970960|dbj|BAD44172.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
TAIR|locus:2065001351 EMB2799 "EMBRYO DEFECTIVE 2799 0.865 0.658 0.604 4.5e-66
TAIR|locus:2065001 EMB2799 "EMBRYO DEFECTIVE 2799" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 672 (241.6 bits), Expect = 4.5e-66, P = 4.5e-66
 Identities = 142/235 (60%), Positives = 167/235 (71%)

Query:     1 MGTISCTNTVSLNGAC--TRFFAADSLSSKAS-SVFFNNRTWKLKLR-PLVAXXXXXXMA 56
             MG ISC +  ++N     T  F+  S S+ +S S+ F  R  + K +           MA
Sbjct:     1 MGFISCISFPTINSRILSTHHFSKHSTSASSSYSLKFALRRQEDKPKVSFFLPLTSSLMA 60

Query:    57 TNFQVTASSSIGAVKEEQKGASSGGVGENDLLIVGPGVLGRLVAEQWRQEHPGCQIYGQT 116
             T  Q ++SS+IG   +  K  S   +G NDLLIVGPGVLGRLVAEQWRQEHP  QI+GQT
Sbjct:    61 TPIQASSSSTIGETSDGLKVQSHVSIGANDLLIVGPGVLGRLVAEQWRQEHPESQIFGQT 120

Query:   117 MTADHHDELINMGITPSLKWTEATQKFPYVIFCAPPSRSLDYPGDVRLAALSWNGEGSFL 176
             +T +HH EL N+GI PSLK TE   KF YVIFCAPPS+S DY G+VR AA +WNGEGSFL
Sbjct:   121 VTTNHHGELENLGIKPSLKGTEYGGKFSYVIFCAPPSQSADYAGEVRNAASNWNGEGSFL 180

Query:   177 FTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLY 231
             FTSSSA YDC DNG C+EDSPVVP+G+SPRTDVLLKAEKV+LE GG VLRLAGLY
Sbjct:   181 FTSSSAPYDCFDNGECNEDSPVVPLGKSPRTDVLLKAEKVVLECGGTVLRLAGLY 235


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.136   0.421    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      267       261   0.00090  114 3  11 22  0.46    33
                                                     32  0.49    36


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  620 (66 KB)
  Total size of DFA:  219 KB (2120 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  20.92u 0.10s 21.02t   Elapsed:  00:00:01
  Total cpu time:  20.92u 0.10s 21.02t   Elapsed:  00:00:01
  Start:  Fri May 10 08:48:00 2013   End:  Fri May 10 08:48:01 2013


GO:0000166 "nucleotide binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009570 "chloroplast stroma" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_VIII2645
hypothetical protein (304 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
cd05266251 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 5e-12
>gnl|CDD|187576 cd05266, SDR_a4, atypical (a) SDRs, subgroup 4 Back     alignment and domain information
 Score = 63.9 bits (156), Expect = 5e-12
 Identities = 44/160 (27%), Positives = 67/160 (41%), Gaps = 22/160 (13%)

Query: 87  LLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITP----SLKWTEATQK 142
           +LI+G G LG+ +A Q   +  G Q+ G T + +        G+TP      +       
Sbjct: 1   VLILGCGYLGQRLARQLLAQ--GWQVTGTTRSPEKLAADRPAGVTPLAADLTQPGLL-AD 57

Query: 143 FPYVIFCAPPSRSLDYPG-DVRLAAL-----SWNGEGSFLFTSSSAIY-DCSDNGAC-DE 194
             +++   PP       G D  L AL             ++ SS+ +Y D    G   DE
Sbjct: 58  VDHLVISLPPPAGSYRGGYDPGLRALLDALAQLPAVQRVIYLSSTGVYGDQ--QGEWVDE 115

Query: 195 DSPVVPIGRSPRTDVLLKAEKVILEFGG---CVLRLAGLY 231
            SP  P   +     LL+AE+ +L  G     +LRLAG+Y
Sbjct: 116 TSPPNP--STESGRALLEAEQALLALGSKPTTILRLAGIY 153


Atypical SDRs in this subgroup are poorly defined, one member is identified as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is related to, but is different from, the archetypical SDRs, GXGXXG. This subgroup also lacks most of the characteristic active site residues of the SDRs; however, the upstream Ser is present at the usual place, and some potential catalytic residues are present in place of the usual YXXXK active site motif. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 251

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 267
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 99.89
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.87
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 99.87
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.87
PLN02427 386 UDP-apiose/xylose synthase 99.86
PLN02166436 dTDP-glucose 4,6-dehydratase 99.85
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 99.85
PLN00016 378 RNA-binding protein; Provisional 99.85
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.84
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.84
PLN02695 370 GDP-D-mannose-3',5'-epimerase 99.83
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.83
PLN02214 342 cinnamoyl-CoA reductase 99.82
PLN02572 442 UDP-sulfoquinovose synthase 99.82
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.82
PLN02206 442 UDP-glucuronate decarboxylase 99.82
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.82
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 99.81
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.81
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.81
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.8
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.79
PLN02260 668 probable rhamnose biosynthetic enzyme 99.79
PLN00198 338 anthocyanidin reductase; Provisional 99.79
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.79
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.79
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 99.78
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.78
CHL00194 317 ycf39 Ycf39; Provisional 99.77
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.77
PLN02896 353 cinnamyl-alcohol dehydrogenase 99.77
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.77
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.76
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.76
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 99.76
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.76
PLN02240 352 UDP-glucose 4-epimerase 99.76
PRK10675 338 UDP-galactose-4-epimerase; Provisional 99.76
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.75
PLN02653340 GDP-mannose 4,6-dehydratase 99.75
PLN02650 351 dihydroflavonol-4-reductase 99.75
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 99.75
KOG1429 350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 99.75
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.74
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.73
PLN02686367 cinnamoyl-CoA reductase 99.71
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 99.7
PRK07201 657 short chain dehydrogenase; Provisional 99.69
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.69
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.68
PLN02583297 cinnamoyl-CoA reductase 99.67
PLN02778298 3,5-epimerase/4-reductase 99.66
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.65
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.65
TIGR01746 367 Thioester-redct thioester reductase domain. It has 99.61
PLN02996 491 fatty acyl-CoA reductase 99.6
PRK05865 854 hypothetical protein; Provisional 99.57
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 99.57
PLN02260668 probable rhamnose biosynthetic enzyme 99.56
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.5
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.49
COG3320 382 Putative dehydrogenase domain of multifunctional n 99.48
PLN03209 576 translocon at the inner envelope of chloroplast su 99.48
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.45
PLN02503 605 fatty acyl-CoA reductase 2 99.44
PRK12320 699 hypothetical protein; Provisional 99.4
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.36
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 99.33
PRK06482276 short chain dehydrogenase; Provisional 99.27
PRK06180277 short chain dehydrogenase; Provisional 99.26
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.24
COG2910211 Putative NADH-flavin reductase [General function p 99.21
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.2
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.19
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.18
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.16
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.15
PRK06138252 short chain dehydrogenase; Provisional 99.15
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.15
PRK06179270 short chain dehydrogenase; Provisional 99.15
PRK06914280 short chain dehydrogenase; Provisional 99.13
PRK12829264 short chain dehydrogenase; Provisional 99.13
PRK05993277 short chain dehydrogenase; Provisional 99.12
PRK09291257 short chain dehydrogenase; Provisional 99.12
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.12
PRK06196315 oxidoreductase; Provisional 99.12
PRK08263275 short chain dehydrogenase; Provisional 99.12
PRK09186256 flagellin modification protein A; Provisional 99.12
PRK07577234 short chain dehydrogenase; Provisional 99.11
PRK12828239 short chain dehydrogenase; Provisional 99.11
PRK09135249 pteridine reductase; Provisional 99.11
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.11
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.11
PRK06182273 short chain dehydrogenase; Validated 99.1
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.08
PRK07060245 short chain dehydrogenase; Provisional 99.08
PRK12827249 short chain dehydrogenase; Provisional 99.08
PRK07774250 short chain dehydrogenase; Provisional 99.07
PRK07067257 sorbitol dehydrogenase; Provisional 99.07
PRK07024257 short chain dehydrogenase; Provisional 99.07
PRK07890258 short chain dehydrogenase; Provisional 99.06
PRK06500249 short chain dehydrogenase; Provisional 99.06
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.06
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.05
PRK10538248 malonic semialdehyde reductase; Provisional 99.04
PRK07454241 short chain dehydrogenase; Provisional 99.03
PRK07074257 short chain dehydrogenase; Provisional 99.03
PRK05693274 short chain dehydrogenase; Provisional 99.02
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.02
PRK08267260 short chain dehydrogenase; Provisional 99.02
PRK06949258 short chain dehydrogenase; Provisional 99.01
PRK05875276 short chain dehydrogenase; Provisional 99.01
PRK12746254 short chain dehydrogenase; Provisional 99.01
PRK07775274 short chain dehydrogenase; Provisional 99.01
PRK06523260 short chain dehydrogenase; Provisional 99.01
PRK08264238 short chain dehydrogenase; Validated 99.01
PRK07806248 short chain dehydrogenase; Provisional 99.01
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.01
PRK08643256 acetoin reductase; Validated 99.0
PRK07102243 short chain dehydrogenase; Provisional 98.99
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 98.99
PRK08219227 short chain dehydrogenase; Provisional 98.99
PRK06181263 short chain dehydrogenase; Provisional 98.98
PRK06101240 short chain dehydrogenase; Provisional 98.98
PRK08251248 short chain dehydrogenase; Provisional 98.98
PRK05717255 oxidoreductase; Validated 98.97
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 98.97
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 98.97
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.97
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.97
PRK12939250 short chain dehydrogenase; Provisional 98.97
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 98.96
PRK06057255 short chain dehydrogenase; Provisional 98.96
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.95
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.95
PRK05866293 short chain dehydrogenase; Provisional 98.95
PRK06197306 short chain dehydrogenase; Provisional 98.95
PRK06194287 hypothetical protein; Provisional 98.93
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.93
PRK08017256 oxidoreductase; Provisional 98.93
PRK07825273 short chain dehydrogenase; Provisional 98.92
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.92
PRK06398258 aldose dehydrogenase; Validated 98.91
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 98.91
PRK05876275 short chain dehydrogenase; Provisional 98.9
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.89
PRK07814263 short chain dehydrogenase; Provisional 98.89
PRK07326237 short chain dehydrogenase; Provisional 98.89
PRK08628258 short chain dehydrogenase; Provisional 98.88
PRK07856252 short chain dehydrogenase; Provisional 98.88
PRK05650270 short chain dehydrogenase; Provisional 98.88
PRK06701290 short chain dehydrogenase; Provisional 98.87
PRK06128300 oxidoreductase; Provisional 98.87
PRK06841255 short chain dehydrogenase; Provisional 98.87
PRK07069251 short chain dehydrogenase; Validated 98.87
PRK07023243 short chain dehydrogenase; Provisional 98.87
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 98.87
PRK06953222 short chain dehydrogenase; Provisional 98.87
PRK12824245 acetoacetyl-CoA reductase; Provisional 98.87
PRK06947248 glucose-1-dehydrogenase; Provisional 98.87
PRK08085254 gluconate 5-dehydrogenase; Provisional 98.87
KOG2865 391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 98.86
PRK06124256 gluconate 5-dehydrogenase; Provisional 98.86
PRK08177225 short chain dehydrogenase; Provisional 98.86
PRK08277278 D-mannonate oxidoreductase; Provisional 98.86
PRK12743256 oxidoreductase; Provisional 98.85
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 98.84
PRK07109 334 short chain dehydrogenase; Provisional 98.84
PRK09242257 tropinone reductase; Provisional 98.84
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.83
PRK06198260 short chain dehydrogenase; Provisional 98.83
PRK07097265 gluconate 5-dehydrogenase; Provisional 98.82
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.82
PRK07063260 short chain dehydrogenase; Provisional 98.82
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 98.81
PRK06123248 short chain dehydrogenase; Provisional 98.81
PRK07478254 short chain dehydrogenase; Provisional 98.81
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.81
PRK12742237 oxidoreductase; Provisional 98.8
PLN02253280 xanthoxin dehydrogenase 98.8
TIGR02415254 23BDH acetoin reductases. One member of this famil 98.8
PRK08324681 short chain dehydrogenase; Validated 98.77
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.77
PRK07985294 oxidoreductase; Provisional 98.76
PRK07832272 short chain dehydrogenase; Provisional 98.76
PRK05855582 short chain dehydrogenase; Validated 98.75
PRK08703239 short chain dehydrogenase; Provisional 98.75
PRK08226263 short chain dehydrogenase; Provisional 98.75
PRK12935247 acetoacetyl-CoA reductase; Provisional 98.75
PRK08265261 short chain dehydrogenase; Provisional 98.75
PRK09134258 short chain dehydrogenase; Provisional 98.75
PRK06172253 short chain dehydrogenase; Provisional 98.74
PRK07035252 short chain dehydrogenase; Provisional 98.74
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.74
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 98.73
PRK12747252 short chain dehydrogenase; Provisional 98.73
PRK06114254 short chain dehydrogenase; Provisional 98.73
PRK08589272 short chain dehydrogenase; Validated 98.73
PRK05867253 short chain dehydrogenase; Provisional 98.72
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 98.71
PRK09072263 short chain dehydrogenase; Provisional 98.71
PRK12937245 short chain dehydrogenase; Provisional 98.7
PRK06483236 dihydromonapterin reductase; Provisional 98.69
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 98.69
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.68
PRK07062265 short chain dehydrogenase; Provisional 98.68
PRK07201657 short chain dehydrogenase; Provisional 98.67
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 98.67
PRK08340259 glucose-1-dehydrogenase; Provisional 98.67
PRK12938246 acetyacetyl-CoA reductase; Provisional 98.66
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 98.66
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 98.65
PRK07576264 short chain dehydrogenase; Provisional 98.65
PRK05872296 short chain dehydrogenase; Provisional 98.64
PRK05854313 short chain dehydrogenase; Provisional 98.63
PRK07904253 short chain dehydrogenase; Provisional 98.63
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.62
PRK06924251 short chain dehydrogenase; Provisional 98.62
PRK06139 330 short chain dehydrogenase; Provisional 98.62
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 98.62
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.62
PRK07677252 short chain dehydrogenase; Provisional 98.61
PRK08936261 glucose-1-dehydrogenase; Provisional 98.61
PRK08339263 short chain dehydrogenase; Provisional 98.59
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 98.57
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 98.57
PRK07041230 short chain dehydrogenase; Provisional 98.57
PRK08278273 short chain dehydrogenase; Provisional 98.57
PRK06484520 short chain dehydrogenase; Validated 98.56
PRK12744257 short chain dehydrogenase; Provisional 98.53
PRK07831262 short chain dehydrogenase; Provisional 98.53
PRK05884223 short chain dehydrogenase; Provisional 98.47
PRK06940275 short chain dehydrogenase; Provisional 98.45
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 98.45
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 98.43
COG0300265 DltE Short-chain dehydrogenases of various substra 98.42
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 98.39
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 98.38
PRK06125259 short chain dehydrogenase; Provisional 98.36
PLN02780320 ketoreductase/ oxidoreductase 98.35
PRK07578199 short chain dehydrogenase; Provisional 98.34
PRK06484 520 short chain dehydrogenase; Validated 98.33
smart00822180 PKS_KR This enzymatic domain is part of bacterial 98.31
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 98.29
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.27
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 98.26
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 98.25
PRK09009235 C factor cell-cell signaling protein; Provisional 98.22
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.22
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.21
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.21
PRK08862227 short chain dehydrogenase; Provisional 98.2
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.2
KOG4288283 consensus Predicted oxidoreductase [General functi 98.19
PRK07424406 bifunctional sterol desaturase/short chain dehydro 98.18
PRK12367245 short chain dehydrogenase; Provisional 98.18
PRK05599246 hypothetical protein; Provisional 98.17
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 98.11
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 98.09
PTZ00325 321 malate dehydrogenase; Provisional 98.08
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 98.07
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 98.06
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 98.06
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.04
PRK07791286 short chain dehydrogenase; Provisional 98.02
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 98.0
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 97.99
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 97.97
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 97.96
PLN00015 308 protochlorophyllide reductase 97.96
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 97.95
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.94
KOG1372 376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 97.94
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.93
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 97.92
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 97.91
PRK08303 305 short chain dehydrogenase; Provisional 97.91
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 97.88
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.88
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.87
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.85
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 97.85
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 97.84
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 97.82
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 97.82
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.81
KOG2774 366 consensus NAD dependent epimerase [General functio 97.81
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 97.79
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.78
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.76
PRK07417279 arogenate dehydrogenase; Reviewed 97.74
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.7
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 97.69
PLN02688266 pyrroline-5-carboxylate reductase 97.68
PLN02353 473 probable UDP-glucose 6-dehydrogenase 97.67
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 97.66
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 97.61
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.61
PRK09620229 hypothetical protein; Provisional 97.6
cd01336 325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.59
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.58
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 97.56
KOG1208314 consensus Dehydrogenases with different specificit 97.56
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 97.55
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.53
PLN00106 323 malate dehydrogenase 97.52
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 97.52
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.51
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 97.51
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 97.5
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.5
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.49
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.48
PLN02712 667 arogenate dehydrogenase 97.48
PRK08507275 prephenate dehydrogenase; Validated 97.46
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.45
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.44
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 97.43
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 97.43
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.42
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.42
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.41
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.41
KOG0725270 consensus Reductases with broad range of substrate 97.41
COG1028251 FabG Dehydrogenases with different specificities ( 97.4
PRK14982340 acyl-ACP reductase; Provisional 97.4
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.4
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 97.4
PRK08309177 short chain dehydrogenase; Provisional 97.38
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.38
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.37
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.36
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.35
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.33
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 97.32
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.32
PRK15059 292 tartronate semialdehyde reductase; Provisional 97.31
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 97.3
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 97.3
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.28
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 97.26
PLN02858 1378 fructose-bisphosphate aldolase 97.25
PRK09496 453 trkA potassium transporter peripheral membrane com 97.24
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 97.24
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.24
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.23
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 97.23
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 97.22
PRK07680273 late competence protein ComER; Validated 97.21
PRK04148134 hypothetical protein; Provisional 97.2
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.2
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.2
PRK06223 307 malate dehydrogenase; Reviewed 97.19
PLN02256304 arogenate dehydrogenase 97.18
KOG0409 327 consensus Predicted dehydrogenase [General functio 97.17
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.17
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 97.13
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 97.13
PRK05086 312 malate dehydrogenase; Provisional 97.12
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.11
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.09
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.08
PRK06720169 hypothetical protein; Provisional 97.08
PRK07574385 formate dehydrogenase; Provisional 97.08
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.06
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 97.05
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.05
PRK08655 437 prephenate dehydrogenase; Provisional 97.05
PRK13243333 glyoxylate reductase; Reviewed 97.03
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 97.03
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.02
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.0
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 96.99
PTZ00117 319 malate dehydrogenase; Provisional 96.99
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 96.99
PLN02712 667 arogenate dehydrogenase 96.99
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 96.98
cd05294 309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.96
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.96
PRK13304265 L-aspartate dehydrogenase; Reviewed 96.95
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 96.95
PRK09496453 trkA potassium transporter peripheral membrane com 96.94
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.92
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.87
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.87
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 96.86
PRK13302271 putative L-aspartate dehydrogenase; Provisional 96.85
PLN03139386 formate dehydrogenase; Provisional 96.84
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 96.84
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 96.84
PTZ00082 321 L-lactate dehydrogenase; Provisional 96.84
PRK06545 359 prephenate dehydrogenase; Validated 96.84
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 96.84
PRK00048257 dihydrodipicolinate reductase; Provisional 96.83
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.81
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.81
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.79
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 96.78
PLN02858 1378 fructose-bisphosphate aldolase 96.78
PRK13403 335 ketol-acid reductoisomerase; Provisional 96.76
TIGR01763 305 MalateDH_bact malate dehydrogenase, NAD-dependent. 96.75
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 96.74
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.74
PRK05479 330 ketol-acid reductoisomerase; Provisional 96.73
PRK10669558 putative cation:proton antiport protein; Provision 96.72
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 96.7
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.69
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.69
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 96.67
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.64
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 96.63
PRK06436303 glycerate dehydrogenase; Provisional 96.62
PRK12480330 D-lactate dehydrogenase; Provisional 96.6
PRK08605332 D-lactate dehydrogenase; Validated 96.59
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.57
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 96.55
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.53
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 96.52
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.52
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 96.51
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 96.49
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.47
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 96.46
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 96.46
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 96.45
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.43
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 96.42
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.42
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 96.42
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.41
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.39
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.38
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.37
PLN02383 344 aspartate semialdehyde dehydrogenase 96.37
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.37
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 96.35
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 96.35
TIGR01758 324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 96.35
PTZ00075476 Adenosylhomocysteinase; Provisional 96.34
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 96.34
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.34
PRK13303265 L-aspartate dehydrogenase; Provisional 96.33
KOG1611249 consensus Predicted short chain-type dehydrogenase 96.33
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.31
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.3
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 96.3
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.3
PTZ00431260 pyrroline carboxylate reductase; Provisional 96.3
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 96.29
PLN02494477 adenosylhomocysteinase 96.29
PRK08818 370 prephenate dehydrogenase; Provisional 96.29
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 96.28
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate d 96.26
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.25
PLN02602 350 lactate dehydrogenase 96.23
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy producti 96.23
PRK03659601 glutathione-regulated potassium-efflux system prot 96.23
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 96.23
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 96.23
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.22
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.22
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.2
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.19
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.19
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.18
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.15
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.14
PRK03562621 glutathione-regulated potassium-efflux system prot 96.14
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.14
TIGR01724 341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 96.08
PRK13940414 glutamyl-tRNA reductase; Provisional 96.08
PLN02928347 oxidoreductase family protein 96.07
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 96.07
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.06
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 96.06
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.05
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 96.05
PRK06719157 precorrin-2 dehydrogenase; Validated 96.03
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 96.03
PLN00203519 glutamyl-tRNA reductase 96.01
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 96.0
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.97
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 95.96
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.96
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 95.87
PRK06141314 ornithine cyclodeaminase; Validated 95.83
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.82
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 95.82
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 95.78
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 95.77
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.72
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.68
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 95.66
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.65
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.62
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 95.57
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 95.56
PRK05442 326 malate dehydrogenase; Provisional 95.52
PRK12557 342 H(2)-dependent methylenetetrahydromethanopterin de 95.51
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.49
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
Probab=99.89  E-value=3e-22  Score=185.28  Aligned_cols=178  Identities=16%  Similarity=0.090  Sum_probs=126.2

Q ss_pred             CCCCeEEEEcc-cHHhHHHHHHHHhcCCCCeEEEEeCCCCCchh----hhc-------cC---eeeecCCc----cccCC
Q 024473           82 VGENDLLIVGP-GVLGRLVAEQWRQEHPGCQIYGQTMTADHHDE----LIN-------MG---ITPSLKWT----EATQK  142 (267)
Q Consensus        82 ~~m~~ILV~Ga-G~IG~~La~~L~~~~pG~~V~~l~R~~~~~~~----l~~-------~~---v~~d~~d~----~~~~~  142 (267)
                      ..||+|||||+ ||||++|+++|+++  |++|++++|.......    +..       ..   +..|+.|.    +.+++
T Consensus        13 ~~~~~vlVtGatGfiG~~lv~~L~~~--g~~V~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~l~~~~~~   90 (348)
T PRK15181         13 LAPKRWLITGVAGFIGSGLLEELLFL--NQTVIGLDNFSTGYQHNLDDVRTSVSEEQWSRFIFIQGDIRKFTDCQKACKN   90 (348)
T ss_pred             ccCCEEEEECCccHHHHHHHHHHHHC--CCEEEEEeCCCCcchhhhhhhhhccccccCCceEEEEccCCCHHHHHHHhhC
Confidence            44689999995 99999999999999  9999999986532111    100       01   23455554    24578


Q ss_pred             CCEEEEccCCCCCC----C-------hHHHHHHHHH--HhCCCCcEEEEcCCccccCCCCCccCCCCCCCCCCCCHHHHH
Q 024473          143 FPYVIFCAPPSRSL----D-------YPGDVRLAAL--SWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDV  209 (267)
Q Consensus       143 ~D~Vi~~a~~~~~~----~-------~~~~~~~l~~--~~~~v~r~V~~SS~~VYg~~~~~~~~E~~p~~p~~~~~y~~~  209 (267)
                      +|+|||+|+.....    +       ++.++.+++.  ...++++|||+||++|||...+.+.+|+++..|.  +.|+.+
T Consensus        91 ~d~ViHlAa~~~~~~~~~~~~~~~~~Nv~gt~nll~~~~~~~~~~~v~~SS~~vyg~~~~~~~~e~~~~~p~--~~Y~~s  168 (348)
T PRK15181         91 VDYVLHQAALGSVPRSLKDPIATNSANIDGFLNMLTAARDAHVSSFTYAASSSTYGDHPDLPKIEERIGRPL--SPYAVT  168 (348)
T ss_pred             CCEEEECccccCchhhhhCHHHHHHHHHHHHHHHHHHHHHcCCCeEEEeechHhhCCCCCCCCCCCCCCCCC--ChhhHH
Confidence            99999999854321    1       2344556653  2347899999999999997655667787776664  689999


Q ss_pred             HHHHHHHHHHc----C--eeEEeeCccccCCc-----------hHHHHH-hCCcceec-CCCccccHHHHHHh
Q 024473          210 LLKAEKVILEF----G--GCVLRLAGLYISLC-----------YLVEKF-QGLPLLLK-SPGIFSANWHYICV  263 (267)
Q Consensus       210 k~~aE~~l~~~----~--~~IlR~~~iyGp~~-----------~~l~~~-~g~~v~~~-~~~~~~n~IH~~~~  263 (267)
                      |+++|++++.+    +  ++++||+++|||+.           .++..+ +|+++.+. ++.+..++||..++
T Consensus       169 K~~~e~~~~~~~~~~~~~~~~lR~~~vyGp~~~~~~~~~~~i~~~~~~~~~~~~i~~~g~g~~~rd~i~v~D~  241 (348)
T PRK15181        169 KYVNELYADVFARSYEFNAIGLRYFNVFGRRQNPNGAYSAVIPRWILSLLKDEPIYINGDGSTSRDFCYIENV  241 (348)
T ss_pred             HHHHHHHHHHHHHHhCCCEEEEEecceeCcCCCCCCccccCHHHHHHHHHcCCCcEEeCCCCceEeeEEHHHH
Confidence            99999987654    3  89999999999962           123333 47776654 44567888886544



>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 2e-18
3ius_A286 Uncharacterized conserved protein; APC63810, silic 1e-14
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
 Score = 82.1 bits (203), Expect = 2e-18
 Identities = 33/158 (20%), Positives = 62/158 (39%), Gaps = 18/158 (11%)

Query: 87  LLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITPSLKWTEATQKFP-- 144
           +LI G G LG  +A +   +  G ++ G   +A      +   +   +   +        
Sbjct: 6   ILIAGCGDLGLELARRLTAQ--GHEVTGLRRSAQPMPAGVQ-TLIADVTRPDTLASIVHL 62

Query: 145 ---YVIFCAPPSRSLD------YPGDVR--LAALSWNGEGSFLFTSSSAIYDCSDNGACD 193
               +++C   S   D      Y   +R  L+AL         F SS+ +Y        D
Sbjct: 63  RPEILVYCVAASEYSDEHYRLSYVEGLRNTLSALEGAPLQHVFFVSSTGVYGQEVEEWLD 122

Query: 194 EDSPVVPIGRSPRTDVLLKAEKVILEFGGCVLRLAGLY 231
           ED+P +   +      +L+AE ++  +   +LR +G+Y
Sbjct: 123 EDTPPIA--KDFSGKRMLEAEALLAAYSSTILRFSGIY 158


>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Length = 286 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.95
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.92
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.91
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.9
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.9
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.89
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.89
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.89
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.88
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.88
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.88
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.87
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.87
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.87
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.87
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.86
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.86
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.86
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.86
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.85
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.85
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.85
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.85
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.85
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.85
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.85
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.85
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.85
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.85
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.85
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 99.85
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.84
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.84
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.84
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.84
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.84
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.83
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 99.83
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.83
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.83
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 99.82
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.82
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.82
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.81
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.81
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.81
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 99.81
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.81
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.81
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.8
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.8
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.8
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.79
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.79
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.79
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.79
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.79
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.79
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.77
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.77
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 99.76
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.76
4f6l_B 508 AUSA reductase domain protein; thioester reductase 99.76
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.76
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.76
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.76
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.76
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.75
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 99.75
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.75
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.74
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 99.73
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.73
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.72
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.71
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 99.71
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.71
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.7
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 99.69
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.68
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.68
1xq6_A253 Unknown protein; structural genomics, protein stru 99.67
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 99.65
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.61
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 99.58
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 99.54
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.54
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.53
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.51
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.51
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.4
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.37
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.37
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.34
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.34
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.33
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.33
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.31
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.31
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.3
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.29
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.28
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.27
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.27
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.27
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.27
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.26
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.26
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.26
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.26
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.25
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.25
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.25
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.24
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.22
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.22
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.22
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.22
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.22
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.22
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.21
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.21
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.21
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.21
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.21
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.21
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.21
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.21
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.2
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.19
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.18
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.18
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.18
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.18
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.17
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.17
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.17
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.17
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.17
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.17
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.17
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.17
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.17
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.16
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.16
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.16
1xkq_A280 Short-chain reductase family member (5D234); parra 99.16
3rih_A293 Short chain dehydrogenase or reductase; structural 99.15
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.15
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.15
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.15
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.15
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.15
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.15
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.15
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.14
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.14
1spx_A278 Short-chain reductase family member (5L265); paral 99.14
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.14
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.14
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.14
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.13
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.13
3cxt_A291 Dehydrogenase with different specificities; rossma 99.13
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.12
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.12
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.12
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.12
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.11
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.11
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.11
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.1
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.1
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.1
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.1
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.1
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.09
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.09
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.09
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.09
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.09
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.09
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.08
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.08
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.08
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.08
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.07
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.07
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.07
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.07
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.07
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.05
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.05
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.05
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.04
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.04
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.04
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.04
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.03
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.03
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.03
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.03
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.03
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.03
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.03
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.02
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.02
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.02
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.02
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.02
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.02
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.02
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.02
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.01
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.01
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.01
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.01
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.01
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.0
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 98.99
1ooe_A236 Dihydropteridine reductase; structural genomics, P 98.99
4eso_A255 Putative oxidoreductase; NADP, structural genomics 98.99
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.99
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 98.99
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 98.98
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.98
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 98.98
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.98
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.97
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 98.97
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 98.97
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.96
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 98.96
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 98.96
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.96
4e4y_A244 Short chain dehydrogenase family protein; structur 98.96
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 98.95
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 98.95
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 98.95
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 98.94
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.94
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.93
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.93
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 98.93
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 98.92
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 98.92
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 98.92
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 98.91
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.91
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 98.91
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 98.9
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 98.9
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 98.9
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 98.9
3tsc_A277 Putative oxidoreductase; structural genomics, seat 98.9
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.9
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 98.89
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.89
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 98.89
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 98.88
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 98.87
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.87
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 98.86
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.85
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 98.85
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 98.84
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 98.83
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.83
3e03_A274 Short chain dehydrogenase; structural genomics, PS 98.83
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 98.81
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 98.79
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 98.77
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.77
3qlj_A322 Short chain dehydrogenase; structural genomics, se 98.76
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.76
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 98.76
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.75
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.75
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.74
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 98.74
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 98.72
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 98.71
3edm_A259 Short chain dehydrogenase; structural genomics, ox 98.69
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.67
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 98.66
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 98.65
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.63
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 98.47
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.46
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 98.42
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 98.41
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.39
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 98.38
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 98.38
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.36
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.35
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.35
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 98.31
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 98.3
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.24
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 98.22
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 98.22
1smk_A 326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.2
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 98.18
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.17
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 98.17
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.17
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.16
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.16
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.16
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 98.15
4ezb_A 317 Uncharacterized conserved protein; structural geno 98.14
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 98.13
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 98.12
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 98.11
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 98.11
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 98.09
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 98.09
3qha_A 296 Putative oxidoreductase; seattle structural genomi 98.09
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 98.08
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 98.06
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 98.06
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 98.06
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.04
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 98.01
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 98.0
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 97.99
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 97.99
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 97.97
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 97.97
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.95
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.95
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.93
1hye_A 313 L-lactate/malate dehydrogenase; nucleotide binding 97.92
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.9
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.89
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 97.89
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 97.88
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.88
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 97.88
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 97.88
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.88
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.87
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 97.86
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 97.86
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 97.86
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.85
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.85
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.83
1ks9_A 291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.82
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.82
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.82
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.81
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.81
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.8
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.79
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.79
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.79
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.78
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 97.77
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.76
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.76
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.75
3hn2_A 312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 97.75
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 97.75
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 97.74
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 97.71
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.71
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 97.69
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.69
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.67
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 97.67
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.66
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.66
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.66
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.66
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.65
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.65
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.64
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.64
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.64
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 97.62
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 97.62
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 96.79
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 97.6
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 97.6
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.58
3g17_A 294 Similar to 2-dehydropantoate 2-reductase; structur 97.58
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 97.58
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 97.58
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.57
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 97.54
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 97.5
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.5
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.49
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.49
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 97.49
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.48
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 97.48
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.48
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 97.47
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.47
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.46
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.46
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 97.45
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 97.44
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.43
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 97.43
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.43
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.42
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.42
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 97.41
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.41
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.41
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.41
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.41
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.41
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 97.39
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.39
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.39
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.37
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.37
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.37
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.35
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.34
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.34
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 97.32
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.32
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.31
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.31
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.31
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 97.31
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 97.3
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 97.3
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 97.27
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.27
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.27
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.24
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.23
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.22
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.22
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.21
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.21
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.21
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 97.2
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.18
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.17
3slk_A795 Polyketide synthase extender module 2; rossmann fo 97.16
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.16
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.16
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.16
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.15
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 97.14
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.13
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 97.12
4g65_A 461 TRK system potassium uptake protein TRKA; structur 97.11
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.11
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.09
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.09
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.08
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.07
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 97.07
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 97.06
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.05
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.05
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.05
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.05
3tl2_A 315 Malate dehydrogenase; center for structural genomi 97.04
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 97.03
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 97.02
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.01
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.0
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 97.0
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.0
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.0
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 96.99
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 96.97
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.97
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 96.95
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 96.94
5mdh_A 333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 96.94
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 96.94
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.93
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.92
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 96.92
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 96.92
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.91
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.91
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.9
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.9
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.89
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.88
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.87
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.85
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 96.85
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 96.83
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.82
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
Probab=99.95  E-value=3.7e-27  Score=208.69  Aligned_cols=177  Identities=20%  Similarity=0.223  Sum_probs=140.2

Q ss_pred             CCCeEEEEcccHHhHHHHHHHHhcCCCCeEEEEeCCCCCchhhhccCeee---ecCCccccCCCCEEEEccCCCCCCC-h
Q 024473           83 GENDLLIVGPGVLGRLVAEQWRQEHPGCQIYGQTMTADHHDELINMGITP---SLKWTEATQKFPYVIFCAPPSRSLD-Y  158 (267)
Q Consensus        83 ~m~~ILV~GaG~IG~~La~~L~~~~pG~~V~~l~R~~~~~~~l~~~~v~~---d~~d~~~~~~~D~Vi~~a~~~~~~~-~  158 (267)
                      |||+|||||+|+||++|+++|+++  |++|++++|++.+...+...+++.   |+.|.+ +.++|+|||+|+.....+ .
T Consensus         4 m~~~ilVtGaG~iG~~l~~~L~~~--g~~V~~~~r~~~~~~~~~~~~~~~~~~D~~d~~-~~~~d~vi~~a~~~~~~~~~   80 (286)
T 3ius_A            4 MTGTLLSFGHGYTARVLSRALAPQ--GWRIIGTSRNPDQMEAIRASGAEPLLWPGEEPS-LDGVTHLLISTAPDSGGDPV   80 (286)
T ss_dssp             -CCEEEEETCCHHHHHHHHHHGGG--TCEEEEEESCGGGHHHHHHTTEEEEESSSSCCC-CTTCCEEEECCCCBTTBCHH
T ss_pred             CcCcEEEECCcHHHHHHHHHHHHC--CCEEEEEEcChhhhhhHhhCCCeEEEecccccc-cCCCCEEEECCCccccccHH
Confidence            678999999999999999999999  999999999987766555455544   455555 889999999999765432 2


Q ss_pred             HHHHHHHHHHh-CCCCcEEEEcCCccccCCCCCccCCCCCCCCCCCCHHHHHHHHHHHHHHHc-C--eeEEeeCccccCC
Q 024473          159 PGDVRLAALSW-NGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEF-G--GCVLRLAGLYISL  234 (267)
Q Consensus       159 ~~~~~~l~~~~-~~v~r~V~~SS~~VYg~~~~~~~~E~~p~~p~~~~~y~~~k~~aE~~l~~~-~--~~IlR~~~iyGp~  234 (267)
                      ...+...+.+. .++++|||+||.+|||...+.+++|++|..|.  +.|+.+|+++|++++++ +  ++|+||+++||++
T Consensus        81 ~~~l~~a~~~~~~~~~~~v~~Ss~~vyg~~~~~~~~E~~~~~p~--~~Y~~sK~~~E~~~~~~~~~~~~ilRp~~v~G~~  158 (286)
T 3ius_A           81 LAALGDQIAARAAQFRWVGYLSTTAVYGDHDGAWVDETTPLTPT--AARGRWRVMAEQQWQAVPNLPLHVFRLAGIYGPG  158 (286)
T ss_dssp             HHHHHHHHHHTGGGCSEEEEEEEGGGGCCCTTCEECTTSCCCCC--SHHHHHHHHHHHHHHHSTTCCEEEEEECEEEBTT
T ss_pred             HHHHHHHHHhhcCCceEEEEeecceecCCCCCCCcCCCCCCCCC--CHHHHHHHHHHHHHHhhcCCCEEEEeccceECCC
Confidence            22233332222 57899999999999998877789999998884  69999999999999998 5  9999999999999


Q ss_pred             chHHHHH-hCCcceecCCCccccHHHHHHhh
Q 024473          235 CYLVEKF-QGLPLLLKSPGIFSANWHYICVK  264 (267)
Q Consensus       235 ~~~l~~~-~g~~v~~~~~~~~~n~IH~~~~~  264 (267)
                      ...+..+ +|.+..+.+++++.++||.-+++
T Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~i~v~Dva  189 (286)
T 3ius_A          159 RGPFSKLGKGGIRRIIKPGQVFSRIHVEDIA  189 (286)
T ss_dssp             BSSSTTSSSSCCCEEECTTCCBCEEEHHHHH
T ss_pred             chHHHHHhcCCccccCCCCcccceEEHHHHH
Confidence            6656555 47766666667888999876554



>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.89
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.89
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.88
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.87
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.86
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.85
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.84
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.83
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.82
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.82
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.82
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.81
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.8
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.79
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.79
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.78
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.78
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.75
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.75
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.74
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.73
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.71
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.71
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.69
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.66
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.6
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.59
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.55
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 99.52
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 99.21
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 98.84
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 98.74
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 98.71
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.69
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 98.68
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 98.67
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 98.66
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.64
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 98.62
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.61
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.61
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 98.6
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.58
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.55
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.53
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 98.53
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.52
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 98.51
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 98.51
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.5
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.49
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 98.49
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.48
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.48
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 98.47
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 98.47
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 98.46
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 98.45
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.45
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.44
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 98.44
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 98.43
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 98.42
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.4
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 98.4
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 98.39
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 98.38
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.38
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 98.36
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.35
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 98.35
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 98.34
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.31
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 98.29
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.29
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.29
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.29
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 98.29
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.27
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.27
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.27
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 98.23
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 98.23
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 98.21
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.18
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.17
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.17
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.14
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.12
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 98.12
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.09
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.09
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.06
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 98.06
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.99
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.99
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.99
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 97.98
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 97.98
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.94
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 97.91
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.87
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.87
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.83
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.82
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.79
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 97.76
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 97.76
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 97.72
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 97.72
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.7
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.66
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.59
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.58
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.57
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.56
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 97.55
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.48
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.48
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.47
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.47
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.45
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.44
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.4
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.38
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 97.34
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.33
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.32
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.3
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.29
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.28
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.24
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.24
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 97.22
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.21
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.16
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 97.12
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 97.1
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.09
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 97.08
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.08
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.04
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 97.04
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.03
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.01
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.01
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 97.0
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.99
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.85
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.85
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.81
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.81
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.8
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.8
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.79
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.77
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.74
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 96.72
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.7
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 96.69
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.62
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.61
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.58
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.58
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.56
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.56
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.51
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.5
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.47
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 96.46
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 96.43
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.43
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.39
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 96.38
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.34
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.33
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.3
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.3
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.28
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 96.26
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.23
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.23
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.19
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.18
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.17
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.16
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.15
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.14
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.11
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.11
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 96.1
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.09
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.07
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.07
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.06
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.06
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.05
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.05
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 96.04
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.03
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.02
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.01
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.99
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 95.99
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 95.99
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 95.97
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.97
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 95.96
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 95.94
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.92
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.92
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.89
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.88
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.84
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.84
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.82
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.81
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.79
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.76
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.76
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.75
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 95.73
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 95.73
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.68
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.59
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.59
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.57
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.55
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.54
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.47
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.38
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 95.37
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 95.35
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.34
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.34
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.3
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.27
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.14
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.08
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 95.03
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.01
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.96
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.86
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 94.84
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.84
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.67
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.65
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.61
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 94.6
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 94.43
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 94.32
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.29
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 94.05
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.0
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.86
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 93.84
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.83
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 93.77
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 93.77
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.68
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 93.66
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 93.65
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 93.42
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 93.24
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 93.12
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 93.1
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.08
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.81
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 92.72
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.68
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 92.67
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 92.67
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 92.59
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 92.56
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 92.39
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 92.23
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.87
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 91.77
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.29
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 91.15
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 90.86
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 90.29
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 90.14
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.72
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 89.7
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 89.57
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 89.32
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 89.31
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 89.29
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 89.19
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 89.16
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 89.02
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 88.82
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 88.81
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 88.76
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 88.67
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 88.64
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 88.4
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 88.32
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 88.01
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 87.38
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 87.02
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 87.0
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.87
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 86.5
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 86.18
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 85.88
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 85.51
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 85.39
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 85.1
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 84.95
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.81
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 84.7
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 84.64
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 84.53
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 84.41
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 83.38
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 83.35
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 82.97
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 82.05
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 81.27
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.78
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 80.53
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 80.5
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 80.28
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 80.16
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: UDP-glucuronate decarboxylase 1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=4.9e-23  Score=183.65  Aligned_cols=175  Identities=17%  Similarity=0.133  Sum_probs=121.8

Q ss_pred             CeEEEEcc-cHHhHHHHHHHHhcCCCCeEEEEeCCCC-Cchhhhc--cCeeeecCCc----cccCCCCEEEEccCCCCC-
Q 024473           85 NDLLIVGP-GVLGRLVAEQWRQEHPGCQIYGQTMTAD-HHDELIN--MGITPSLKWT----EATQKFPYVIFCAPPSRS-  155 (267)
Q Consensus        85 ~~ILV~Ga-G~IG~~La~~L~~~~pG~~V~~l~R~~~-~~~~l~~--~~v~~d~~d~----~~~~~~D~Vi~~a~~~~~-  155 (267)
                      +||||||+ ||||++|+++|+++  |++|++++|... ....+..  .....++.+.    ....++|+|||+|+.... 
T Consensus         2 KKIlVtG~sGfiG~~lv~~L~~~--g~~V~~~d~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~d~VihlAa~~~~~   79 (312)
T d2b69a1           2 KRILITGGAGFVGSHLTDKLMMD--GHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPP   79 (312)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHT--TCEEEEEECCSSCCGGGTGGGTTCTTEEEEECCTTSCCCCCCSEEEECCSCCSHH
T ss_pred             CEEEEECCCcHHHHHHHHHHHHC--cCEEEEEeCCCcCCHHHHHHhcCCCceEEEehHHHHHHHcCCCEEEECcccCCch
Confidence            78999996 99999999999999  999999987432 2222211  1122333221    245689999999986542 


Q ss_pred             ---CC-------hHHHHHHHHHHh--CCCCcEEEEcCCccccCCCCCccCCC-----CCCCCCCCCHHHHHHHHHHHHHH
Q 024473          156 ---LD-------YPGDVRLAALSW--NGEGSFLFTSSSAIYDCSDNGACDED-----SPVVPIGRSPRTDVLLKAEKVIL  218 (267)
Q Consensus       156 ---~~-------~~~~~~~l~~~~--~~v~r~V~~SS~~VYg~~~~~~~~E~-----~p~~p~~~~~y~~~k~~aE~~l~  218 (267)
                         .+       ++.++.+++.+.  .+ .++||+||..|||.....+++|+     +|..|  .+.|+.+|+++|.+++
T Consensus        80 ~~~~~~~~~~~~Nv~g~~~ll~~~~~~~-~k~I~~SS~~vy~~~~~~~~~e~~~~~~~~~~p--~~~Y~~sK~~~E~~~~  156 (312)
T d2b69a1          80 NYMYNPIKTLKTNTIGTLNMLGLAKRVG-ARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGP--RACYDEGKRVAETMCY  156 (312)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHHHHHHHHT-CEEEEEEEGGGGBSCSSSSBCTTCCCBCCSSST--THHHHHHHHHHHHHHH
T ss_pred             hHHhCHHHHHHHHHHHHHHHHHHHHHcC-CcEEEEEChheecCCCCCCCCccccCCCCCCCC--ccHHHHHHHHHHHHHH
Confidence               11       233455554322  24 48999999999998665555554     45555  4689999999999987


Q ss_pred             Hc----C--eeEEeeCccccCCc---------hHHHHH-hCCcceec-CCCccccHHHHHHhh
Q 024473          219 EF----G--GCVLRLAGLYISLC---------YLVEKF-QGLPLLLK-SPGIFSANWHYICVK  264 (267)
Q Consensus       219 ~~----~--~~IlR~~~iyGp~~---------~~l~~~-~g~~v~~~-~~~~~~n~IH~~~~~  264 (267)
                      .+    +  +++|||+++|||+.         .++.++ .|+++.+. ++.+..++||.-+++
T Consensus       157 ~~~~~~~~~~~~lR~~~vyGp~~~~~~~~~i~~~i~~~~~g~~i~i~~~g~~~r~~i~v~D~~  219 (312)
T d2b69a1         157 AYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLV  219 (312)
T ss_dssp             HHHHHHCCCEEEEEECCEECTTCCTTCCCHHHHHHHHHHHTCCEEEESSSCCEEECEEHHHHH
T ss_pred             HHHHHhCCcEEEEEeeeEECCCCCCCCccHHHHHHHHHHcCCCeEEeCCCCeeEccEEHHHHH
Confidence            64    3  89999999999972         234444 58888664 455778899876653



>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure