Citrus Sinensis ID: 024474


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MLSFVMWKLPEGMEQWKKELEEWLNRGIEFINQIPPTQLYIACAVLLLTTALLLLLQVFRRKKSTTIVLAGLSGSGKTVLFYQLRDGSTHQGTVTSMEPNEDTFVLHSESTKGKIKPVHLVDVPGHSRLRPKLDEFLPQAAGIVFVVDALEFLPNCSAASEYLYDILTNSTVVKKKIPVLICCNKTDKVTAHTKEFIRKQMEKEIDKLRASRSAVSEADVTNDFTLGIPGQAFSFSQCHNKVSVAEASGLTGEISQVEQFIREQVKP
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHcccccccccccccccccEEEEEcccccccccccEEEEEcccccHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEccccccEEEEEEEcccccccHHHHHHHHHccc
***FVMWKLPEGMEQWKKELEEWLNRGIEFINQIPPTQLYIACAVLLLTTALLLLLQVFRRKKSTTIVLAGLSGSGKTVLFYQLRDGSTHQGTVTSMEPNEDTFVLHSESTKGKIKPVHLVDVPGHSRLRPKLDEFLPQAAGIVFVVDALEFLPNCSAASEYLYDILTNSTVVKKKIPVLICCNKTDKVTAHTKEFIRKQMEKEIDK************VTNDFTLGIPGQAFSFSQCHNKVSVAEASGLTGEISQVEQFIREQVKP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSFVMWKLPEGMEQWKKELEEWLNRGIEFINQIPPTQLYIACAVLLLTTALLLLLQVFRRKKSTTIVLAGLSGSGKTVLFYQLRDGSTHQGTVTSMEPNEDTFVLHSESTKGKIKPVHLVDVPGHSRLRPKLDEFLPQAAGIVFVVDALEFLPNCSAASEYLYDILTNSTVVKKKIPVLICCNKTDKVTAHTKEFIxxxxxxxxxxxxxxxxxxxxxDVTNDFTLGIPGQAFSFSQCHNKVSVAEASGLTGEISQVEQFIREQVKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle receptor subunit beta Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.probableP36057

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NRJ, chain B
Confidence level:very confident
Coverage over the Query: 62-265
View the alignment between query and template
View the model in PyMOL
Template: 3GEE, chain A
Confidence level:confident
Coverage over the Query: 11-85,106-122,135-208,240-266
View the alignment between query and template
View the model in PyMOL