Citrus Sinensis ID: 024484

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKATTAHDHQSAESAMSPQASSSSDELSSVTTGETNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
ccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccc
cccccccHHcccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHccccc
mgrapccekmglkkgpwtpeeDRILIVHIKkhghpnwralpkqagllrcgksCRLRWINylrpdikrgnfskeEEETIINLHDMLGNRWsaiagrlpgrtdneiKNVWHTHLKKKAAAVLKQNQKantntnnnnnsddhkqnskattahdhqsaesamspqassssdelssvttgetnnnnnsdrycmdkyvkgdheqnvdsfesfpvidesfwtdtslsenssnltsdfggglnefaighhdygggmDFWYNILVTsgadsltlpf
mgrapccekmglkkgpwtpeEDRILIVHIKKhghpnwralpkqaGLLRCGKSCRLRWINylrpdikrgnfskEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKantntnnnnnsddhKQNSKATTAHDHQSAESAMSPQASSSSDELSsvttgetnnnnnsdrYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKAntntnnnnnSDDHKQNSKATTAHDHQsaesamspqassssdelssVTTGETNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTdtslsenssnltsdFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
***************PWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVW**********************************************************************************YV********DSFESFPVIDESFWTDT*********TSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSG********
*GRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLK********************************************************************************************************************************HDYGGGMDFWYNILVTSGAD*LTLPF
MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNN*****************************************TNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
***APCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLK***************************************************************************************************************************GGGMDFWYNILVTSGADSL*LPF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVLKQNQKANTNTNNNNNSDDHKQNSKATTAHDHQSAESAMSPQASSSSDELSSVTTGETNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSDFGGGLNEFAIGHHDYGGGMDFWYNILVTSGADSLTLPF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query267 2.2.26 [Sep-21-2011]
Q7XBH4257 Myb-related protein Myb4 yes no 0.928 0.964 0.507 2e-62
P20024340 Myb-related protein Zm1 O N/A no 0.483 0.379 0.709 2e-52
Q9SZP1282 Transcription repressor M no no 0.430 0.407 0.713 7e-47
Q9S9K9257 Transcription factor MYB3 no no 0.677 0.704 0.513 9e-47
Q38850249 Transcription repressor M no no 0.756 0.811 0.442 1e-46
P81393232 Myb-related protein 308 O N/A no 0.430 0.495 0.704 2e-46
P81392316 Myb-related protein 306 O N/A no 0.430 0.363 0.686 2e-46
Q38851236 Transcription repressor M no no 0.760 0.860 0.466 3e-46
P27898 399 Myb-related protein P OS= N/A no 0.685 0.458 0.495 5e-46
P81395274 Myb-related protein 330 O N/A no 0.441 0.430 0.694 7e-46
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function desciption
 Score =  239 bits (610), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/260 (50%), Positives = 166/260 (63%), Gaps = 12/260 (4%)

Query: 1   MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINY 60
           MGRAPCCEKMGLKKGPWTPEED++L+ HI++HGH NWRALPKQAGLLRCGKSCRLRWINY
Sbjct: 1   MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINY 60

Query: 61  LRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVL 120
           LRPDIKRGNFSKEEE+TII+LH++LGNRWSAIA RLPGRTDNEIKNVWHTHLKK+  A  
Sbjct: 61  LRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLDAPA 120

Query: 121 KQNQKANTNTNNNNNSDDHKQNSKATTAHDHQSAESAMSPQASSSSDELSSVTTGETNNN 180
           +    A +          HK+   A       +A  A   +++SSS   SS+ +     +
Sbjct: 121 QGGHVAASGGKK------HKKPKSAKKPAAAAAAPPASPERSASSSVTESSMASSVAEEH 174

Query: 181 NNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTDT-SLSENSSNLTSDFGGGLNEFAI 239
            N+        V    E +  S      ID+SFW++T S+  +  +++ + G      A 
Sbjct: 175 GNAGISSASASVCAKEESSFTSASEEFQIDDSFWSETLSMPLDGYDVSMEPGD-----AF 229

Query: 240 GHHDYGGGMDFWYNILVTSG 259
                   MD+W  + + SG
Sbjct: 230 VAPPSADDMDYWLGVFMESG 249
Putative transcription factor which is may be involved in cold stress response.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P81392|MYB06_ANTMA Myb-related protein 306 OS=Antirrhinum majus GN=MYB306 PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
224099907287 predicted protein [Populus trichocarpa] 0.910 0.846 0.535 1e-70
327412635272 putative MYB transcription factor [Rosa 0.940 0.922 0.510 6e-68
356498363264 PREDICTED: myb-related protein Myb4-like 0.898 0.909 0.496 7e-68
5139806264 GmMYB29A2 [Glycine max] 0.898 0.909 0.496 8e-68
217337738238 myb-related transcription factor [Panax 0.838 0.941 0.543 1e-67
22266675253 myb-related transcription factor VlMYBB1 0.887 0.936 0.511 2e-67
359806618272 uncharacterized protein LOC100807569 [Gl 0.925 0.908 0.487 3e-67
359807202275 MYB29 protein [Glycine max] gi|6492385|d 0.932 0.905 0.493 4e-67
297831064285 AtMYB15/AtY19/MYB15 [Arabidopsis lyrata 0.958 0.898 0.519 5e-67
20561280 protein 2 [Petunia x hybrida] 0.947 0.903 0.512 1e-66
>gi|224099907|ref|XP_002311670.1| predicted protein [Populus trichocarpa] gi|222851490|gb|EEE89037.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 152/284 (53%), Positives = 185/284 (65%), Gaps = 41/284 (14%)

Query: 1   MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINY 60
           M RAPCCEKMGLK+GPWTPEED+ILI +++K+GH NWRALPKQAGL RCGKSCRLRW+NY
Sbjct: 1   MVRAPCCEKMGLKRGPWTPEEDQILISYVQKYGHSNWRALPKQAGLQRCGKSCRLRWVNY 60

Query: 61  LRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVL 120
           LRPDIKRGNFSKEEEE II LH++LGNRWSAIA RLPGRTDNEIKNVWHTHL K+    L
Sbjct: 61  LRPDIKRGNFSKEEEEAIIKLHEILGNRWSAIASRLPGRTDNEIKNVWHTHLLKR----L 116

Query: 121 KQNQKANT-------NTNNNNNSDDHKQNSKATTAHDHQSAESA-MSPQASS---SSDEL 169
           KQN +  +       + + N+N      NS   +    +S E A +SPQ SS   SS   
Sbjct: 117 KQNGEPKSQQHIRIPDCHLNDNKLSQSANSTIPSLSGCKSIEYAQISPQPSSSDHSSVTD 176

Query: 170 SSVTTGETNNNNNSDRYCMDKYVKGDHEQNVDSFESFPVIDESFWTDTSLSENSSNLTSD 229
           +SVTT ETNN            +K    +N+DS E +PVIDE FW++  + ENS   +S+
Sbjct: 177 TSVTTSETNNTG---------LIKV---ENIDSSEIYPVIDEDFWSEPEMVENSGMPSSN 224

Query: 230 FGGGLNEFAIGHHD-------YGGG------MDFWYNILVTSGA 260
           F    ++F     D       YG G      M+FWYN+ + SG 
Sbjct: 225 FLDD-SQFPFPSPDTMERAGCYGYGPKVDDNMEFWYNLFIKSGG 267

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|327412635|emb|CCA29106.1| putative MYB transcription factor [Rosa rugosa] Back     alignment and taxonomy information
>gi|356498363|ref|XP_003518022.1| PREDICTED: myb-related protein Myb4-like [Glycine max] Back     alignment and taxonomy information
>gi|5139806|dbj|BAA81732.1| GmMYB29A2 [Glycine max] Back     alignment and taxonomy information
>gi|217337738|gb|ACK43221.1| myb-related transcription factor [Panax ginseng] Back     alignment and taxonomy information
>gi|22266675|dbj|BAC07544.1| myb-related transcription factor VlMYBB1-2 [Vitis labrusca x Vitis vinifera] Back     alignment and taxonomy information
>gi|359806618|ref|NP_001241018.1| uncharacterized protein LOC100807569 [Glycine max] gi|5139814|dbj|BAA81736.1| GmMYB29B2 [Glycine max] gi|255642060|gb|ACU21296.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359807202|ref|NP_001241360.1| MYB29 protein [Glycine max] gi|6492385|dbj|BAA81733.2| GmMYB29A2 [Glycine max] gi|255644995|gb|ACU22997.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297831064|ref|XP_002883414.1| AtMYB15/AtY19/MYB15 [Arabidopsis lyrata subsp. lyrata] gi|297329254|gb|EFH59673.1| AtMYB15/AtY19/MYB15 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|20561|emb|CAA78387.1| protein 2 [Petunia x hybrida] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query267
TAIR|locus:2086233285 MYB15 "myb domain protein 15" 0.782 0.733 0.537 1.8e-60
TAIR|locus:2038520246 MYB13 "myb domain protein 13" 0.554 0.601 0.682 2.6e-57
TAIR|locus:2042526249 MYB14 "myb domain protein 14" 0.430 0.461 0.834 6.9e-57
TAIR|locus:2075387321 MYB107 "myb domain protein 107 0.430 0.358 0.791 1.5e-51
TAIR|locus:2098906299 MYB17 "myb domain protein 17" 0.430 0.384 0.747 3.3e-51
TAIR|locus:2149000336 MYB9 "myb domain protein 9" [A 0.430 0.342 0.791 1.3e-50
TAIR|locus:2207330294 MYB63 "myb domain protein 63" 0.434 0.394 0.758 2.3e-48
TAIR|locus:2141231350 MYB102 "MYB-like 102" [Arabido 0.430 0.328 0.765 4.7e-48
TAIR|locus:2032860274 MYB58 "myb domain protein 58" 0.531 0.518 0.619 6e-48
TAIR|locus:2011786296 MYB72 "myb domain protein 72" 0.554 0.5 0.593 6e-48
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 577 (208.2 bits), Expect = 1.8e-60, Sum P(2) = 1.8e-60
 Identities = 121/225 (53%), Positives = 143/225 (63%)

Query:     1 MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINY 60
             MGRAPCCEKMGLK+GPWTPEED+IL+  I  HGH NWRALPKQAGLLRCGKSCRLRW+NY
Sbjct:     1 MGRAPCCEKMGLKRGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNY 60

Query:    61 LRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVL 120
             L+PDIKRGNF+KEEE+ II+LH +LGNRWSAIA +LPGRTDNEIKNVWHTHLKK+    L
Sbjct:    61 LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKR----L 116

Query:   121 KQNQKAXXXXXXXXXSDDHKQNSKATTAHDHQXXXXXXXXXX-XXXXXXXXXVTTGETNN 179
             +  Q A             K  S  T+++  +                     +T E ++
Sbjct:   117 EDYQPAKPKTSNKKKGTKPKSESVITSSNSTRSESELADSSNPSGESLFSTSPSTSEVSS 176

Query:   180 NN--NSDRYC----MDKYVKGDH---EQNVDSFESFPV-IDESFW 214
                 + D Y     MD    GD    +Q   SFE+F   IDESFW
Sbjct:   177 MTLISHDGYSNEINMDNK-PGDISTIDQECVSFETFGADIDESFW 220
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP;RCA
GO:0009733 "response to auxin stimulus" evidence=IEP;RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP;RCA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0010200 "response to chitin" evidence=IEP;RCA
GO:0002679 "respiratory burst involved in defense response" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0052542 "defense response by callose deposition" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207330 MYB63 "myb domain protein 63" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032860 MYB58 "myb domain protein 58" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011786 MYB72 "myb domain protein 72" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7XBH4MYB4_ORYSJNo assigned EC number0.50760.92880.9649yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 6e-57
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 1e-56
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 1e-15
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-13
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 1e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 6e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 8e-05
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 3e-04
TIGR03658 895 TIGR03658, IsdH_HarA, haptoglobin-binding heme upt 0.003
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  188 bits (478), Expect = 6e-57
 Identities = 95/178 (53%), Positives = 115/178 (64%), Gaps = 20/178 (11%)

Query: 1   MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINY 60
           MGR  CC K  L+KG W+PEED  L+ HI K+GH  W ++PKQAGL RCGKSCRLRWINY
Sbjct: 1   MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINY 60

Query: 61  LRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAAVL 120
           LRPD+KRG FS++EE  II LH +LGNRWS IA +LPGRTDNEIKN+W++ LKKK    L
Sbjct: 61  LRPDLKRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKK----L 116

Query: 121 KQNQKANTNTNNNNNSDDHKQNSKATTAHDHQSAESAMSPQASSSSDELSSVTTGETN 178
           +Q +  + NT        HK  S+     D         P     SD+ SSV + E N
Sbjct: 117 RQ-RGIDPNT--------HKPLSEVENGEDKN-------PPTDDKSDKASSVVSNELN 158

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information
>gnl|CDD|132697 TIGR03658, IsdH_HarA, haptoglobin-binding heme uptake protein HarA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 267
PLN03091 459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.78
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.73
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.65
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.64
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.58
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.47
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.46
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.37
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.29
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.29
PLN03212249 Transcription repressor MYB5; Provisional 99.2
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.19
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.07
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.04
PLN03091 459 hypothetical protein; Provisional 99.0
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.88
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.78
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.43
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.7
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.66
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.64
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.62
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.37
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.37
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.33
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.29
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.19
KOG1279506 consensus Chromatin remodeling factor subunit and 96.98
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.92
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.82
KOG1279506 consensus Chromatin remodeling factor subunit and 96.65
PRK13923170 putative spore coat protein regulator protein YlbO 96.62
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.55
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.14
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.89
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.6
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.47
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.34
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.08
KOG2656 445 consensus DNA methyltransferase 1-associated prote 94.88
KOG4282345 consensus Transcription factor GT-2 and related pr 94.78
PRK13923170 putative spore coat protein regulator protein YlbO 94.33
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 94.31
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 94.04
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 93.72
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 91.21
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 89.8
smart0059589 MADF subfamily of SANT domain. 84.92
KOG1194 534 consensus Predicted DNA-binding protein, contains 84.5
PF11035 344 SnAPC_2_like: Small nuclear RNA activating complex 81.45
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 80.83
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.4e-39  Score=305.50  Aligned_cols=118  Identities=67%  Similarity=1.223  Sum_probs=114.6

Q ss_pred             CCCCcccccCCCCCCCCCHHHHHHHHHHHHHhCCCCccccccccCcccCcccccccccccccCCCCCCCCCHHHHHHHHH
Q 024484            1 MGRAPCCEKMGLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIIN   80 (267)
Q Consensus         1 m~R~~~~~k~~lkkg~WT~EED~~L~~~V~~~G~~nW~~Ia~~~~~~Rt~kqCr~Rw~n~L~p~ikk~~WT~EED~~Li~   80 (267)
                      |||++||+|.+++||+||+|||++|+++|++||..+|..||+.++.+|+++|||+||.+||+|.+++++||+|||++|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999998866999999999999999999999999999999999


Q ss_pred             HHHhhCCchhHHhhcCCCCCHHHHHHHHHHHhHHHHHH
Q 024484           81 LHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKAAA  118 (267)
Q Consensus        81 l~~~~G~kWs~IA~~lpgRT~~q~KnRw~~~lkk~~~~  118 (267)
                      +|++||++|+.||++|||||+++|||||+.++||+++.
T Consensus        81 L~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~  118 (459)
T PLN03091         81 LHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQ  118 (459)
T ss_pred             HHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999998554

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF11035 SnAPC_2_like: Small nuclear RNA activating complex subunit 2-like; InterPro: IPR021281 This family of proteins is SnAPC subunit 2-like Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 8e-22
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 1e-21
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 9e-21
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 1e-20
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 1e-20
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 1e-16
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 2e-11
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 3e-08
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 3e-08
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 3e-07
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 2e-05
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 4e-05
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 4e-05
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (249), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 70/105 (66%), Gaps = 1/105 (0%)
Query: 12  LKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFS 71
           L KGPWT EED+ +I  +KK+G   W  + K     R GK CR RW N+L P++K+ +++
Sbjct: 5   LVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKG-RLGKQCRERWHNHLNPEVKKSSWT 63
Query: 72  KEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKKA 116
           +EE+  I   H +LGNRW+ IA  LPGRTDN +KN W++ +K+K 
Sbjct: 64  EEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query267
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-68
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 8e-68
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-67
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-18
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 7e-57
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 5e-56
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-35
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-07
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 6e-53
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 7e-29
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-24
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-21
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 1e-14
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 4e-06
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-10
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 4e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-08
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 4e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 3e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 3e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 5e-07
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-04
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-06
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 2e-06
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 6e-06
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 1e-05
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-04
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 3e-05
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 1e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 3e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 4e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  205 bits (525), Expect = 2e-68
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 12  LKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFS 71
           L KGPWT EED+ +I  ++K+G   W  + K     R GK CR RW N+L P++K+ +++
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72  KEEEETIINLHDMLGNRWSAIAGRLPGRTDNEIKNVWHTHLKKK 115
           +EE+  I   H  LGNRW+ IA  LPGRTDN IKN W++ +++K
Sbjct: 61  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK 104
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.85
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.84
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.79
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.79
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.74
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.72
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.71
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.7
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.7
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.69
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.69
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.68
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.67
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.67
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.66
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.65
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.64
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.63
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.62
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.61
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.6
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.38
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.59
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.59
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.58
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.57
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.56
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.56
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.54
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.51
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.49
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.44
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.43
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.43
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.42
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.41
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.41
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.4
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.4
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.39
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.39
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.37
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.37
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.35
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.01
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.33
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.31
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.3
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.27
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.13
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.07
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.97
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.96
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.82
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.72
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.68
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.67
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.6
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.52
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.52
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.4
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.36
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.29
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.62
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.27
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.21
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.18
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.17
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.08
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.8
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.7
2crg_A70 Metastasis associated protein MTA3; transcription 97.67
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.67
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.42
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.38
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.2
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.97
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.95
2crg_A70 Metastasis associated protein MTA3; transcription 96.91
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.55
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.53
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.43
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.42
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.43
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.32
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 94.18
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.37
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 87.89
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 83.13
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=5.9e-36  Score=236.09  Aligned_cols=104  Identities=46%  Similarity=0.878  Sum_probs=99.7

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCccccccccCcccCcccccccccccccCCCCCCCCCHHHHHHHHHHHHhhCCchh
Q 024484           11 GLKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLGNRWS   90 (267)
Q Consensus        11 ~lkkg~WT~EED~~L~~~V~~~G~~nW~~Ia~~~~~~Rt~kqCr~Rw~n~L~p~ikk~~WT~EED~~Li~l~~~~G~kWs   90 (267)
                      ++++|+||+|||++|+.+|++||..+|..||+.+++ |+++||++||.++|+|.+++++||+|||++|++++.+||++|+
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTSTT-CCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhhcC-CCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            478999999999999999999998899999999987 9999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCCCHHHHHHHHHHHhHHH
Q 024484           91 AIAGRLPGRTDNEIKNVWHTHLKKK  115 (267)
Q Consensus        91 ~IA~~lpgRT~~q~KnRw~~~lkk~  115 (267)
                      .||++|||||+++||+||+.+++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~  104 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRK  104 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC--
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhcc
Confidence            9999999999999999999999876
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 267
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-21
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-19
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-09
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 3e-16
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-16
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-12
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 4e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-15
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 2e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-12
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 8e-08
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 8e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 8e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 4e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 5e-10
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 8e-10
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 5e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 6e-05
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 81.7 bits (202), Expect = 4e-21
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 12 LKKGPWTPEEDRILIVHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINYLRPD 64
          L KGPWT EED+ LI  ++K+G   W  + K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query267
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.76
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.75
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.74
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.59
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.55
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.54
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.53
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.52
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.48
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.48
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.46
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.46
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.45
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.45
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.42
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.38
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.32
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.31
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.29
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.25
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.24
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.21
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.92
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.9
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.74
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.29
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.23
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.66
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.66
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.64
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.89
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.61
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.55
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 94.82
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.63
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 92.89
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 92.32
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 84.44
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.76  E-value=2.4e-21  Score=146.76  Aligned_cols=72  Identities=18%  Similarity=0.193  Sum_probs=66.7

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCC-----CccccccccCcccCcccccccccccccCCCCCCCCCHHHHHHHHHHHHhhC
Q 024484           14 KGPWTPEEDRILIVHIKKHGHP-----NWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEETIINLHDMLG   86 (267)
Q Consensus        14 kg~WT~EED~~L~~~V~~~G~~-----nW~~Ia~~~~~~Rt~kqCr~Rw~n~L~p~ikk~~WT~EED~~Li~l~~~~G   86 (267)
                      |++||+|||++|+++|.+||..     +|..||+.|++ ||++|||.||.++|+|.+++++||.+||++|++++..+.
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lpg-Rt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~li   77 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPN-HTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLI   77 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTSTT-SCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCBC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcCC-CCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhccc
Confidence            6899999999999999999964     49999999998 999999999999999999999999999999988776554
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure