Citrus Sinensis ID: 024490


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MGTMDVEWLLDFLKGMIKPLAATAVVLLAVLLSFLQKLGIEGEMIYSIVRAFLQLSVIGFVLQFIFSQDNRGWIILAYLFMVIVAGYTAGQRAKHVPRGKYVAGASILAGTAVTMLMLVVLNVFPFTPRYIIPVAGMMVGNAMTVTGVTMKRLRDDIKIQLNLVETALALGATPRQATKQQVKRSLVIALSPVLDNAKTVGLISLPGAMTGMIMGGASPLEAIQLQIVVMNMLIGASTVSSIMSTYLCWPAFFTKAYQLESKVFRTD
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
*GTMDVEWLLDFLKGMIKPLAATAVVLLAVLLSFLQKLGIEGEMIYSIVRAFLQLSVIGFVLQFIFSQDNRGWIILAYLFMVIVAGYTAGQRAKHVPRGKYVAGASILAGTAVTMLMLVVLNVFPFTPRYIIPVAGMMVGNAMTVTGVTMKRLRDDIKIQLNLVETALALGATPRQATKQQVKRSLVIALSPVLDNAKTVGLISLPGAMTGMIMGGASPLEAIQLQIVVMNMLIGASTVSSIMSTYLCWPAFFTKAYQLE*******
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTMDVEWLLDFLKGMIKPLAATAVVLLAVLLSFLQKLGIEGEMIYSIVRAFLQLSVIGFVLQFIFSQDNRGWIILAYLFMVIVAGYTAGQRAKHVPRGKYVAGASILAGTAVTMLMLVVLNVFPFTPRYIIPVAGMMVGNAMTVTGVTMKRLRDDIKIQLNLVETALALGATPRQATKQQVKRSLVIALSPVLDNAKTVGLISLPGAMTGMIMGGASPLEAIQLQIVVMNMLIGASTVSSIMSTYLCWPAFFTKAYQLESKVFRTD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein ALUMINUM SENSITIVE 3 Required for aluminum (Al) resistance/tolerance, probably by translocating Al from sensitive tissues such as growing roots to tissues less sensisitive to the toxic effects of Al.confidentQ9ZUT3
UPF0014 membrane protein STAR2 Associates with STAR2 to form a functional transmembrane ABC transporter required for detoxification of aluminum (Al) in roots. Can specifically transport UDP-glucose.confidentQ5W7C1
UPF0014 membrane protein YjkA probableO34684

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D31, chain C
Confidence level:probable
Coverage over the Query: 133-190
View the alignment between query and template
View the model in PyMOL
Template: 3RLF, chain F
Confidence level:probable
Coverage over the Query: 132-210
View the alignment between query and template
View the model in PyMOL