Citrus Sinensis ID: 024528


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MSTVKNTFFISHGSPTLSIDESLPARHFLKAWKEQVFTQRPNSILVISGHWETDVPTVNVVQQNDVIYDFYNFPEQMYKLKYPAPGAPELAKRVKQLLTESGFNHVNEDTKRGLDHGAWVPLMLMYPEANIPVCQLSVQTRKDGTHHYNMGKALAPLKDEGVLIIGSGSATHNLRALQFDGDSVASWASEFDNWLKDALLQGRYEDVNHYEQKAPCAKKAHPWPDHFYPLHVAMGAAGENANAELIHTSWQLGTISYSSYKFTAAD
ccccccEEEEcccccccccccccHHHHHHHHHHHHcccccccEEEEEccccccccccEECcccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccEEEEccccccccEEEEEccccccHHHHHHHHHHHcccccccEEEEECccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHcccccccccHHHHHHHccccccccEEEEEcCEEEcCEEEEEEEEcccc
*STVKNTFFISHGSPTLSIDESLPARHFLKAWKEQVFTQRPNSILVISGHWETDVPTVNVVQQNDVIYDFYNFPEQMYKLKYPAPGAPELAKRVKQLLTESGFNHVNEDTKRGLDHGAWVPLMLMYPEANIPVCQLSVQTRKDGTHHYNMGKALAPLKDEGVLIIGSGSATHNLRALQFDGDSVASWASEFDNWLKDALLQGRYEDVNHYEQKAPCAKKAHPWPDHFYPLHVAMGAAGENANAELIHTSWQLGTISYSSYKFTAA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTVKNTFFISHGSPTLSIDESLPARHFLKAWKEQVFTQRPNSILVISGHWETDVPTVNVVQQNDVIYDFYNFPEQMYKLKYPAPGAPELAKRVKQLLTESGFNHVNEDTKRGLDHGAWVPLMLMYPEANIPVCQLSVQTRKDGTHHYNMGKALAPLKDEGVLIIGSGSATHNLRALQFDGDSVASWASEFDNWLKDALLQGRYEDVNHYEQKAPCAKKAHPWPDHFYPLHVAMGAAGENANAELIHTSWQLGTISYSSYKFTAAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4,5-DOPA dioxygenase extradiol-like protein May be involved in the metabolism of aromatic compounds.probableQ949R4
4,5-DOPA dioxygenase extradiol Opens the cyclic ring of dihydroxy-phenylalanine (DOPA) between carbons 4 and 5, thus producing an unstable seco-DOPA that rearranges nonenzymatically to betalamic acid.probableQ7XA48

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PW6, chain A
Confidence level:very confident
Coverage over the Query: 6-60,75-263
View the alignment between query and template
View the model in PyMOL