Citrus Sinensis ID: 024544


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MVSGSNGTTSFMTDFLQKCGGYSVVDGGFATELERHGADLNDPLWSAKCLVSSPHLVRKVHLDYLDAGANIIITASYQATIQGFEAKGFSTEEAEALLRRSVEIACEAREIYYDRCMKDSWDFTGSGRISSRPVLVAASVGSYGAYLADGSEYSGDYGDAVSLETLKEFHRRRVLILANSGADLIAFETIPNKLEAKAYAELLEEEGITIPAWFSFNSKDGINVVSGDSILECASIADSCEQVVAVGINCTSPRFIHGLILSVRKV
cccccccccHHHHHHHHHccccEEECccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccEEEcccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcc
**********FMTDFLQKCGGYSVVDGGFATELERHGADLNDPLWSAKCLVSSPHLVRKVHLDYLDAGANIIITASYQATIQGFEAKGFSTEEAEALLRRSVEIACEAREIYYDRCMKDSWDFTG*GRISSRPVLVAASVGSYGAYLADGSEYSGDYGDAVSLETLKEFHRRRVLILANSGADLIAFETIPNKLEAKAYAELLEEEGITIPAWFSFNSKDGINVVSGDSILECASIADSCEQVVAVGINCTSPRFIHGLILSVRKV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSGSNGTTSFMTDFLQKCGGYSVVDGGFATELERHGADLNDPLWSAKCLVSSPHLVRKVHLDYLDAGANIIITASYQATIQGFEAKGFSTEEAEALLRRSVEIACEAREIYYDRCMKDSWDFTGSGRISSRPVLVAASVGSYGAYLADGSEYSGDYGDAVSLETLKEFHRRRVLILANSGADLIAFETIPNKLEAKAYAELLEEEGITIPAWFSFNSKDGINVVSGDSILECASIADSCEQVVAVGINCTSPRFIHGLILSVRKV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homocysteine S-methyltransferase 3 Catalyzes methyl transfer from S-methylmethionine (SMM) to adenosyl-L-homocysteine (AdoMet). SMM degradation (by HMT-1, HMT-2 and HMT-3) and biosynthesis (by MMT1) constitute the SMM cycle in plants, which is probably required to achieve short term control of AdoMet level.probableQ8LAX0
Selenocysteine methyltransferase Catalyzes the methylation of selenocysteine with S-methylmethionine as donor. Does not methylate cysteine.probableP56707

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.10Homocysteine S-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LT8, chain A
Confidence level:very confident
Coverage over the Query: 10-83,94-111,132-148,160-264
View the alignment between query and template
View the model in PyMOL