Citrus Sinensis ID: 024581


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MDDYTREMMDLKTLVTRTLEKKGVLAKIRAELRASVFEAIEEEDRVIEKDEGLPPALLGSCNDRAKQLHASPSGRLLTALICEYLDWAQLNHTMKVYLPECNLQKDAWKAELKEFSSKNGYDLNKNGDSAPLLLDVLEGFLKFENSSQARITGRRQPDSESMSHFESRNARRPSSSSVAGGLPPLGRPIPASQASDRRAAGSSMSAYRKDEYNWRYDSDELSDDVVRASAALENLQLDRKARNLTTSWRHAGDGMSDDDGRPDHM
cHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHccccccccHHHHHHHHHHHHHccccccHHHHcccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
****TREMMDLKTLVTRTLEKKGVLAKIRAELRASVFEAIEE***V*************************PSGRLLTALICEYLDWAQLNHTMKVYLPECNLQKDAWKAELKEFS**NGYDLN***DSAPLLLDVLEGFLKF**********************************************************************WR**************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDYTREMMDLKTLVTRTLEKKGVLAKIRAELRASVFEAIEEEDRVIEKDEGLPPALLGSCNDRAKQLHASPSGRLLTALICEYLDWAQLNHTMKVYLPECNLQKDAWKAELKEFSSKNGYDLNKNGDSAPLLLDVLEGFLKFENSSQARITGRRQPDSESMSHFESRNARRPSSSSVAGGLPPLGRPIPASQASDRRAAGSSMSAYRKDEYNWRYDxxxxxxxxxxxxxxxxxxxxxRKARNLTTSWRHAGDGMSDDDGRPDHM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TONNEAU 1b Involved in the control of the dynamic organization of the cortical cytoskeleton. May play a role in the organization of microtubule arrays at the centrosome through interaction with centrin 1 (CEN1).probableQ9FQ24
Protein TONNEAU 1a Involved in the control of the dynamic organization of the cortical cytoskeleton. May play a role in the organization of microtubule arrays at the centrosome through interaction with centrin 1 (CEN1).probableQ9FQ25

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D68, chain A
Confidence level:confident
Coverage over the Query: 61-139
View the alignment between query and template
View the model in PyMOL