Citrus Sinensis ID: 024618

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MNPYVGHPNPLKEGQELFRKGLLSEAVLALEAEVLKNPENSEGWRLLGIAHAENDDDQQAIAAMMRAHEAEPTNLEVLLSLGVSHTNELEQAAALKYLYGWLRHHPKYGTIAPPELSDSLYYADVARLFVEAARMSPEDADVHIVLGVLYNLSRQYDKAIESFQTALKLKPQDYSLWNKLGATQANSVQSADAILAYQRALDLKPNYVRAWANMGISYANQGMYEESVRYYVRALAMNPKADNAWQYLRISLRYAGRYPNRGDIF
cccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHcc
MNPYVGHPNPLKEGQELFRKGLLSEAVLALEAEVLKNPENSEGWRLLGIAHAENDDDQQAIAAMMRAHEAEPTNLEVLLSLGVSHTNELEQAAALKYLYGWLRHHPKYGTIAPPELSDSLYYADVARLFVEAARMSPEDADVHIVLGVLYNLSRQYDKAIESFQTALKLKPQDYSLWNKLGATQANSVQSADAILAYQRALDLKPNYVRAWANMGISYANQGMYEESVRYYVRALAMNPKADNAWQYLRISLRYAGRYPNRGDIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPYVGHPNPLKEGQELFRKGLLSEAVLALEAEVLKNPENSEGWRLLGIAHAENDDDQQAIAAMMRAHEAEPTNLEVLLSLGVSHTNELEQAAALKYLYGWLRHHPKYGTIAPPELSDSLYYADVARLFVEAARMSPEDADVHIVLGVLYNLSRQYDKAIESFQTALKLKPQDYSLWNKLGATQANSVQSADAILAYQRALDLKPNYVRAWANMGISYANQGMYEESVRYYVRALAMNPKADNAWQYLRISLRYAGRYPNRGDIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisome biogenesis protein 5 Import receptor for peroxisomal-targeting signal one (PTS1). A receptor-cargo complex composed of PEX5, PEX7, a PTS1-containing protein and a PTS2-containing protein is targeted to peroxisomes during import. Necessary for the developmental elimination of obsolete peroxisome matrix proteins.probableQ9FMA3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GW1, chain A
Confidence level:very confident
Coverage over the Query: 7-265
View the alignment between query and template
View the model in PyMOL