Citrus Sinensis ID: 024665

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MRPPRGRGGGGGFRGGRGDGGGRGRGGGRGGGGGRGGGSAMRGRGGGRGGGRGGGRGRGGGGMKGGSKVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQVCFLCLILFQPIVINNLQSVNNETKGGIFEFLFSLFLN
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcCCccccEEEEEccccEEEEEcccccccccccEEEEEEcccccEEEEEEccccHHHHHHHHHccccccccccccEEEEEcccccccccccccEEccccEEEEEEccccHHHHHHHHHHccccEEEcccccccccccccccccccEEEECcccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcc
************************************************************************PHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQVCFLCLILFQPIVINNLQSVNNETKGGIFEFLFSLFLN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPPRGRGGGGGFRGGRGDGGGRGRGGGRGGGGGRGGGSAMRGRGGGRGGGRGGGRGRGGGGMKGGSKVVVEPHRHEGVFIAKGKEDALVTKNLVAGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAVLGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPNGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQVCFLCLILFQPIVINNLQSVNNETKGGIFEFLFSLFLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable mediator of RNA polymerase II transcription subunit 36b Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.probableQ9FEF8
rRNA 2'-O-methyltransferase fibrillarin Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.probableQ22053
rRNA 2'-O-methyltransferase fibrillarin Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.probableQ756P0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IPX, chain A
Confidence level:very confident
Coverage over the Query: 71-238
View the alignment between query and template
View the model in PyMOL
Template: 3AJD, chain A
Confidence level:confident
Coverage over the Query: 99-111,125-257
View the alignment between query and template
View the model in PyMOL