Citrus Sinensis ID: 024723

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---

MPLPVSLWQLHYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKVEDNILLSLEKPTWLIVMANFFVVVHVIGSYQIYAMPVFDMIETLLVKKLNFSPTRLLRFVVRNLYVASTMFIGITFPFFGGLLGFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWCINWICIVLGLCLMILSPIGGLRQIILQAKDYKFYS

ccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc

MPLPVSLWQLHYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPS*P**PSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKVEDNILLSLEKPTWLIVMANFFVVVHVIGSYQIYAMPVFDMIETLLVKKLNFSPTRLLRFVVRNLYVASTMFIGITFPFFGGLLGFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWCINWICIVLGLCLMILSPIGGLRQIILQAKDYKFYS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lysine histidine transporter 1	Amino acid-proton symporter. Transporter with a broad specificity for histidine, lysine, glutamic acid, alanine, serine, proline and glycine. Involved in both apoplastic transport of amino acids in leaves and their uptake by roots.	probable	Q9FKS8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:probable
Coverage over the Query: 44-222
View the alignment between query and template
View the model in PyMOL