Citrus Sinensis ID: 024752


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MSDFREQRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGSVCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAYHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKVAMNQLTKNLACEWAKDKIRVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATSYVTGQVICVDGGYSVTGF
ccccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccHHHHccccHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccEEEEccccccccc
******Q*WSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGSVCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAYHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKVAMNQLTKNLACEWAKDKIRVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATSYVTGQVICVDGGYSVTGF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDFREQRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGSVCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAYHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKVAMNQLTKNLACEWAKDKIRVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATSYVTGQVICVDGGYSVTGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dehydrogenase/reductase SDR family member 4 Reduces all-trans-retinal and 9-cis retinal. Can also catalyze the oxidation of all-trans-retinol with NADP as co-factor, but with much lower efficiency. Reduces alkyl phenyl ketones and alpha-dicarbonyl compounds with aromatic rings, such as pyrimidine-4-aldehyde, 3-benzoylpyridine, 4-benzoylpyridine, menadione and 4-hexanoylpyridine. Has no activity towards aliphatic aldehydes and ketones.probableQ8WNV7
3-oxoacyl-[acyl-carrier-protein] reductase FabG Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis.probableP0A0H9
Uncharacterized oxidoreductase Mb1385 probableP66782

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XQ1, chain A
Confidence level:very confident
Coverage over the Query: 6-148,159-197,227-262
View the alignment between query and template
View the model in PyMOL