Citrus Sinensis ID: 024753


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MSSSYLSLSTSLKNSRICFDIYAEITDRQLKNNDDFVWAIEVPLTGKFIIDVEFLDLKIAPSDGGEPCSIWAEGITQKRSNATALASLGRMLTEGIHTDIIINASNGSTGAHRAVLAARSPVFRSMFSHDLKEKELSTIDIPDMSIDACQAFLSYIYGNIEHEEFLTHRLALLRAADKYDICDLKEACHDSLVEDIDTKNVLERLQNAYLYQLPKLKSSCMRYLVKFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKGF
ccccEEEEEcccccccEEEEEccccccccccccccCEEEEEEEECcEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEEccCEECHHHHHHHcccHHHHHHccccccccccccEEEccccHHHHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHcccccc
****YLSLSTSLKNSRICFDIYAEITDRQLKNNDDFVWAIEVPLTGKFIIDVEFLDLKIAPSDGGEPCSIWAEGITQKRSNATALASLGRMLTEGIHTDIIINASNGSTGAHRAVLAARSPVFRSMFSHDLKEKELSTIDIPDMSIDACQAFLSYIYGNIEHEEFLTHRLALLRAADKYDICDLKEACHDSLVEDIDTKNVLERLQNAYLYQLPKLKSSCMRYLVKFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKGF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSYLSLSTSLKNSRICFDIYAEITDRQLKNNDDFVWAIEVPLTGKFIIDVEFLDLKIAPSDGGEPCSIWAEGITQKRSNATALASLGRMLTEGIHTDIIINASNGSTGAHRAVLAARSPVFRSMFSHDLKEKELSTIDIPDMSIDACQAFLSYIYGNIEHEEFLTHRLALLRAADKYDICDLKEACHDSLVEDIDTKNVLERLQNAYLYQLPKLKSSCMRYLVKFGKIFDIRDDFSVFLQCADRELIAEVFHEVLGAWKGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
BTB/POZ domain-containing protein At1g55760 May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.probableQ680K8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HQI, chain A
Confidence level:very confident
Coverage over the Query: 28-227
View the alignment between query and template
View the model in PyMOL
Template: 3I3N, chain A
Confidence level:very confident
Coverage over the Query: 76-260
View the alignment between query and template
View the model in PyMOL