Citrus Sinensis ID: 024762

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MVTGNNSHQEDGDRQQPAAKGGGATRSWGTTVSGQSVSTSGSVGSPSQSMATPASDSTFLRLNHLDIHGDDAGSQGAVVGGKKKKRGQRAGGGDKSGRGLRQFSMKVCEKVESKGRTTYNEVADELVAEFADPSNSLATPDQQQYDEKNIRRRVYDALNVLMAMDIISKDKKEIQWKGLPRTSLNDIEELKAERLGLRNRIEKKTAYLQELEDQFVGLQNLIQRNERLYSSGNAPSGGVALPFILVQVDIRQLFSCIMASIIT
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccCEccEEEEEEccccEEEEEEccccc
******************************************************************************************************FSMKVCEKVESKGRTTYNEVADELVA********************NIRRRVYDALNVLMAMDIISKDKKEIQWKGLPRTSLNDIEELKAERLGLRNRIEKKTAYLQELEDQFVGLQNLIQRNERLYSSGNAPSGGVALPFILVQVDIRQLFSCIMASI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTGNNSHQEDGDRQQPAAKGGGATRSWGTTVSGQSVSTSGSVGSPSQSMATPASDSTFLRLNHLDIHGDDAGSQGAVVGGKKKKRGQRAGGGDKSGRGLRQFSMKVCEKVESKGRTTYNEVADELVAEFADPSNSLATPDQQQYDEKNIRRRVYDALNVLMAMDIISKDKKEIQWKGLPRTSLNDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYSSGNAPSGGVALPFILVQVDIRQLFSCIMASIIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor-like protein DPB Involved in the regulation of the G1/S transition. Increases the DNA binding activity of E2F proteins after heterodimerization. The complex DPB/E2FC restricts cell division and lateral root initiation and may function as a negative regulator of E2F-regulated genes. The interaction with SKP2A is controlled by auxin.probableQ9FNY2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CF7, chain B
Confidence level:very confident
Coverage over the Query: 97-180
View the alignment between query and template
View the model in PyMOL
Template: 2AZE, chain A
Confidence level:very confident
Coverage over the Query: 183-260
View the alignment between query and template
View the model in PyMOL