Citrus Sinensis ID: 024771


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MESLDLQVCCIDDLLDFNINDDECGKPTKRPRNALSSVNRNGCDFDVFEAGDDTDRLFPECAEEELEWLSNFPTVETFVDISSNPNILKQQSPNSVLENSNSSSSTSTNGSTITNGNNNSNSIIMNCCGNLRVPVRARSKLRTRCRRELLNQEAWWGSVHGSVKAAKPVVSKVIIGRKCQHCGAEKTPQWRAGPMGPKTLCNACGVRFKSGRLVPEYRPANSPTFSSELHSNSHRKVVEMRRQKQMMGIELGVLGVKPVDKG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccc
****DLQVCCIDDLLDFNIND********************************TDRLFPECAEEELEWLSNFPTV****************************************************************************************************GRKCQHCGAEKTPQWRAGPMGPKTLCNACGVRFKSGRLV************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESLDLQVCCIDDLLDFNINDDECGKPTKRPRNALSSVNRNGCDFDVFEAGDDTDRLFPECAEEELEWLSNFPTVETFVDISSNPNILKQQSPNSVLENSNSSSSTSTNGSTITNGNNNSNSIIMNCCGNLRVPVRARSKLRTRCRRELLNQEAWWGSVHGSVKAAKPVVSKVIIGRKCQHCGAEKTPQWRAGPMGPKTLCNACGVRFKSGRLVPEYRPANSPTFSSELHSNSHRKVVEMRRQKQMMGIELGVLGVKPVDKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GATA transcription factor 1 Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes.probableQ8LAU9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KAE, chain A
Confidence level:confident
Coverage over the Query: 176-219
View the alignment between query and template
View the model in PyMOL
Template: 2ZJR, chain Z
Confidence level:probable
Coverage over the Query: 131-156,169-209
View the alignment between query and template
View the model in PyMOL