Citrus Sinensis ID: 024815
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 262 | 2.2.26 [Sep-21-2011] | |||||||
| P25776 | 458 | Oryzain alpha chain OS=Or | yes | no | 0.946 | 0.541 | 0.771 | 1e-107 | |
| P43297 | 462 | Cysteine proteinase RD21a | yes | no | 0.973 | 0.551 | 0.730 | 1e-106 | |
| P20721 | 346 | Low-temperature-induced c | N/A | no | 0.996 | 0.754 | 0.679 | 5e-97 | |
| P25777 | 466 | Oryzain beta chain OS=Ory | no | no | 0.942 | 0.530 | 0.692 | 1e-95 | |
| Q7XR52 | 490 | Cysteine protease 1 OS=Or | no | no | 0.938 | 0.502 | 0.603 | 2e-79 | |
| Q94B08 | 376 | Germination-specific cyst | no | no | 0.591 | 0.412 | 0.670 | 3e-60 | |
| P25251 | 328 | Cysteine proteinase COT44 | N/A | no | 0.587 | 0.469 | 0.677 | 1e-59 | |
| O65039 | 360 | Vignain OS=Ricinus commun | N/A | no | 0.618 | 0.45 | 0.640 | 1e-53 | |
| Q9STL4 | 361 | KDEL-tailed cysteine endo | no | no | 0.599 | 0.434 | 0.626 | 3e-53 | |
| P43156 | 360 | Thiol protease SEN102 OS= | N/A | no | 0.591 | 0.430 | 0.626 | 1e-51 |
| >sp|P25776|ORYA_ORYSJ Oryzain alpha chain OS=Oryza sativa subsp. japonica GN=Os04g0650000 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 389 bits (998), Expect = e-107, Method: Compositional matrix adjust.
Identities = 192/249 (77%), Positives = 219/249 (87%), Gaps = 1/249 (0%)
Query: 1 MDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVA 60
MDYAF+FII+NGGIDTE+DYPYK D CD RKNAKVVTID YEDV N E +LQKAVA
Sbjct: 197 MDYAFDFIINNGGIDTEDDYPYKGKDERCDVNRKNAKVVTIDSYEDVTPNSETSLQKAVA 256
Query: 61 NQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWG 120
NQPVSVAIE GG AFQLY SGIFTG+CGT+LDHGV AVGYGTENG DYWIV+NSWG SWG
Sbjct: 257 NQPVSVAIEAGGRAFQLYSSGIFTGKCGTALDHGVAAVGYGTENGKDYWIVRNSWGKSWG 316
Query: 121 EAGYIRMERNVAGTLTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPE 180
E+GY+RMERN+ + +GKCGIA+E SYP+KKG+NPPNPGP+PPSPT PP VCDNYY+CP+
Sbjct: 317 ESGYVRMERNIKAS-SGKCGIAVEPSYPLKKGENPPNPGPTPPSPTPPPTVCDNYYTCPD 375
Query: 181 SNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVR 240
S TCCC++EYG C+AWGCCPLE ATCCDDHYSCCPH+YPICNV+ GTCLM+KD+PL V+
Sbjct: 376 STTCCCIYEYGKYCYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKDSPLAVK 435
Query: 241 ALRRTPAKP 249
AL+RT AKP
Sbjct: 436 ALKRTLAKP 444
|
Oryza sativa subsp. japonica (taxid: 39947) EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: - |
| >sp|P43297|RD21A_ARATH Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P20721|CYSPL_SOLLC Low-temperature-induced cysteine proteinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P25777|ORYB_ORYSJ Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q7XR52|CYSP1_ORYSJ Cysteine protease 1 OS=Oryza sativa subsp. japonica GN=CP1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|P25251|CYSP4_BRANA Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O65039|CYSEP_RICCO Vignain OS=Ricinus communis GN=CYSEP PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9STL4|CEP2_ARATH KDEL-tailed cysteine endopeptidase CEP2 OS=Arabidopsis thaliana GN=CEP2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P43156|CYSP_HEMSP Thiol protease SEN102 OS=Hemerocallis sp. GN=SEN102 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 262 | ||||||
| 225458701 | 467 | PREDICTED: cysteine proteinase RD21a-lik | 1.0 | 0.561 | 0.824 | 1e-119 | |
| 147790682 | 469 | hypothetical protein VITISV_001146 [Viti | 1.0 | 0.558 | 0.820 | 1e-118 | |
| 302142276 | 388 | unnamed protein product [Vitis vinifera] | 1.0 | 0.675 | 0.824 | 1e-118 | |
| 255538210 | 469 | cysteine protease, putative [Ricinus com | 0.996 | 0.556 | 0.805 | 1e-118 | |
| 146216004 | 461 | cysteine protease Cp6 [Actinidia delicio | 0.992 | 0.563 | 0.820 | 1e-116 | |
| 109390302 | 457 | cysteine protease [Hevea brasiliensis] | 0.992 | 0.568 | 0.804 | 1e-115 | |
| 118486542 | 465 | unknown [Populus trichocarpa] | 0.996 | 0.561 | 0.805 | 1e-115 | |
| 224136808 | 456 | predicted protein [Populus trichocarpa] | 0.996 | 0.572 | 0.805 | 1e-115 | |
| 148927394 | 469 | cysteine proteinase [Elaeis guineensis] | 0.996 | 0.556 | 0.813 | 1e-114 | |
| 148927382 | 470 | cysteine proteinase [Elaeis guineensis] | 0.988 | 0.551 | 0.803 | 1e-114 |
| >gi|225458701|ref|XP_002284973.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 433 bits (1114), Expect = e-119, Method: Compositional matrix adjust.
Identities = 216/262 (82%), Positives = 237/262 (90%)
Query: 1 MDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVA 60
MDYAFEFII+NGGID+EEDYPYKA DG CD YRKNAKVVTID YEDVP NDEK+L+KAVA
Sbjct: 206 MDYAFEFIINNGGIDSEEDYPYKASDGRCDQYRKNAKVVTIDGYEDVPENDEKSLEKAVA 265
Query: 61 NQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWG 120
NQPVSVAIE GG FQLY+SGIFTGRCGT+LDHGVTAVGYGTENG DYWIVKNSWG+SWG
Sbjct: 266 NQPVSVAIEAGGREFQLYQSGIFTGRCGTALDHGVTAVGYGTENGVDYWIVKNSWGASWG 325
Query: 121 EAGYIRMERNVAGTLTGKCGIAMEASYPIKKGQNPPNPGPSPPSPTKPPAVCDNYYSCPE 180
E GYIRMER++A + TGKCGIAMEASYPIKKGQNPPNPGPSPPSP KPP VCDNYY+CPE
Sbjct: 326 EEGYIRMERDLATSATGKCGIAMEASYPIKKGQNPPNPGPSPPSPIKPPTVCDNYYACPE 385
Query: 181 SNTCCCVFEYGNSCFAWGCCPLEAATCCDDHYSCCPHDYPICNVRAGTCLMSKDNPLGVR 240
S+TCCC+FEY CF WGCCPLEAATCC+DH SCCP +YP+CNVRAGTC+MSKDNPLGV+
Sbjct: 386 SSTCCCIFEYAKYCFQWGCCPLEAATCCEDHDSCCPQEYPVCNVRAGTCMMSKDNPLGVK 445
Query: 241 ALRRTPAKPYWAHGNQGGSSSA 262
AL+RT AKP+WA+G G SSA
Sbjct: 446 ALKRTAAKPHWAYGGDGKRSSA 467
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147790682|emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302142276|emb|CBI19479.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255538210|ref|XP_002510170.1| cysteine protease, putative [Ricinus communis] gi|223550871|gb|EEF52357.1| cysteine protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|146216004|gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa] | Back alignment and taxonomy information |
|---|
| >gi|109390302|gb|ABG33750.1| cysteine protease [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|118486542|gb|ABK95110.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224136808|ref|XP_002326950.1| predicted protein [Populus trichocarpa] gi|222835265|gb|EEE73700.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|148927394|gb|ABR19828.1| cysteine proteinase [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
| >gi|148927382|gb|ABR19827.1| cysteine proteinase [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 262 | ||||||
| TAIR|locus:2825832 | 462 | RD21A "responsive to dehydrati | 0.557 | 0.316 | 0.741 | 9.6e-101 | |
| TAIR|locus:2167821 | 463 | RD21B "esponsive to dehydratio | 0.958 | 0.542 | 0.674 | 7.4e-98 | |
| TAIR|locus:2090614 | 452 | AT3G19390 [Arabidopsis thalian | 0.919 | 0.533 | 0.596 | 2.7e-84 | |
| TAIR|locus:2024362 | 437 | XBCP3 "xylem bark cysteine pep | 0.900 | 0.540 | 0.498 | 3.8e-62 | |
| TAIR|locus:2090629 | 362 | AT3G19400 [Arabidopsis thalian | 0.557 | 0.403 | 0.617 | 8.5e-49 | |
| TAIR|locus:2157712 | 361 | CEP1 "cysteine endopeptidase 1 | 0.557 | 0.404 | 0.641 | 1.2e-47 | |
| TAIR|locus:2128243 | 364 | AT4G11310 [Arabidopsis thalian | 0.557 | 0.401 | 0.601 | 1.4e-46 | |
| TAIR|locus:2128253 | 371 | AT4G11320 [Arabidopsis thalian | 0.557 | 0.393 | 0.587 | 7.9e-46 | |
| TAIR|locus:2152445 | 346 | SAG12 "senescence-associated g | 0.557 | 0.421 | 0.587 | 1.3e-45 | |
| TAIR|locus:2038515 | 343 | AT1G06260 [Arabidopsis thalian | 0.553 | 0.422 | 0.625 | 2.7e-45 |
| TAIR|locus:2825832 RD21A "responsive to dehydration 21A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 614 (221.2 bits), Expect = 9.6e-101, Sum P(2) = 9.6e-101
Identities = 109/147 (74%), Positives = 127/147 (86%)
Query: 1 MDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVA 60
MDYAFEFII NGGIDT++DYPYK +DG+CD RKNAKVVTID YEDVP E++L+KAVA
Sbjct: 205 MDYAFEFIIKNGGIDTDKDYPYKGVDGTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVA 264
Query: 61 NQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWG 120
+QP+S+AIE GG AFQLY+SGIF G CGT LDHGV AVGYGTENG DYWIV+NSWG SWG
Sbjct: 265 HQPISIAIEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWG 324
Query: 121 EAGYIRMERNVAGTLTGKCGIAMEASY 147
E+GY+RM RN+A + +GKCGIA+E SY
Sbjct: 325 ESGYLRMARNIASS-SGKCGIAIEPSY 350
|
|
| TAIR|locus:2167821 RD21B "esponsive to dehydration 21B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090614 AT3G19390 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024362 XBCP3 "xylem bark cysteine peptidase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090629 AT3G19400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157712 CEP1 "cysteine endopeptidase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128243 AT4G11310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128253 AT4G11320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152445 SAG12 "senescence-associated gene 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2038515 AT1G06260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P25776 | ORYA_ORYSJ | 3, ., 4, ., 2, 2, ., - | 0.7710 | 0.9465 | 0.5414 | yes | no |
| P43297 | RD21A_ARATH | 3, ., 4, ., 2, 2, ., - | 0.7304 | 0.9732 | 0.5519 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 262 | |||
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 1e-76 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 1e-58 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 8e-36 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 5e-30 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 2e-26 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 2e-21 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 7e-19 | |
| smart00277 | 51 | smart00277, GRAN, Granulin | 7e-18 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 1e-14 | |
| pfam00396 | 43 | pfam00396, Granulin, Granulin | 1e-13 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 1e-12 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 6e-12 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 3e-06 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 3e-06 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 2e-04 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 2e-04 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
Score = 230 bits (590), Expect = 1e-76
Identities = 87/151 (57%), Positives = 100/151 (66%), Gaps = 7/151 (4%)
Query: 1 MDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVA 60
D AFE+I NGGI TE DYPY A DG+C + N+K I Y DVP NDE+ALQ A+A
Sbjct: 68 PDNAFEYIKKNGGIVTESDYPYTAHDGTCKFKKSNSKYAKIKGYGDVPYNDEEALQAALA 127
Query: 61 -NQPVSVAIEGGGMAFQLYESGIFTG-RCGTSLDHGVTAVGYGTENGADYWIVKNSWGSS 118
N PVSVAI+ FQLY+SG++ C LDH V VGYGTENG YWIVKNSWG+
Sbjct: 128 KNGPVSVAIDAYEDDFQLYKSGVYKHTECSGELDHAVLIVGYGTENGVPYWIVKNSWGTD 187
Query: 119 WGEAGYIRMERNVAGTLTGKCGIAMEASYPI 149
WGE GY R+ R V +CGIA EASYPI
Sbjct: 188 WGENGYFRIARGV-----NECGIASEASYPI 213
|
Length = 213 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|197621 smart00277, GRAN, Granulin | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|215898 pfam00396, Granulin, Granulin | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 262 | |||
| KOG1542 | 372 | consensus Cysteine proteinase Cathepsin F [Posttra | 100.0 | |
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| KOG1543 | 325 | consensus Cysteine proteinase Cathepsin L [Posttra | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 99.97 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 99.97 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 99.95 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.95 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.94 | |
| KOG4296 | 90 | consensus Epithelin/granulin [Signal transduction | 99.94 | |
| KOG1544 | 470 | consensus Predicted cysteine proteinase TIN-ag [Ge | 99.92 | |
| smart00277 | 51 | GRAN Granulin. | 99.86 | |
| PF00396 | 43 | Granulin: Granulin; InterPro: IPR000118 Metazoan g | 99.74 | |
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.67 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.59 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 98.95 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 96.67 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 95.85 | |
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 90.93 | |
| COG4990 | 195 | Uncharacterized protein conserved in bacteria [Fun | 87.4 |
| >KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-37 Score=284.88 Aligned_cols=140 Identities=39% Similarity=0.778 Sum_probs=122.3
Q ss_pred ChHHHHHHHHcCCCCCCCCCCcccCCC-CccCCCCCceEEEEeeeeeCCCchHHHHHHHHH-cCCeEEEEeccccccccc
Q 024815 1 MDYAFEFIIDNGGIDTEEDYPYKAIDG-SCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVA-NQPVSVAIEGGGMAFQLY 78 (262)
Q Consensus 1 ~~~A~~yl~~~gGi~~E~~YPY~~~~~-~C~~~~~~~~~~~i~~y~~v~~~~~~~lk~al~-~GPV~v~i~a~~~~f~~Y 78 (262)
|++||+|+++.+||..|++|||++..+ .|...+ ...++.|.+|..++. +|++|.+.|. +|||+|+|++. .+|+|
T Consensus 224 ~~nA~~~~~~~gGL~~E~dYPY~g~~~~~C~~~~-~~~~v~I~~f~~l~~-nE~~ia~wLv~~GPi~vgiNa~--~mQ~Y 299 (372)
T KOG1542|consen 224 MDNAFKYIKKAGGLEKEKDYPYTGKKGNQCHFDK-SKIVVSIKDFSMLSN-NEDQIAAWLVTFGPLSVGINAK--PMQFY 299 (372)
T ss_pred hhHHHHHHHHhCCccccccCCccccCCCccccch-hhceEEEeccEecCC-CHHHHHHHHHhcCCeEEEEchH--HHHHh
Confidence 679999988889999999999999987 998764 566789999999987 5666666555 69999999974 79999
Q ss_pred cCcEEec---cCCCC-CCeEEEEEEeeeeC-CeEEEEEECCCCCCCCCCceEEEecccCCCccCceeeeceeccee
Q 024815 79 ESGIFTG---RCGTS-LDHGVTAVGYGTEN-GADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPI 149 (262)
Q Consensus 79 ~sGIy~~---~c~~~-~~HaVliVGYg~~~-G~~YWIVkNSWGt~WGe~GY~rI~rg~~~~~~g~CgI~~~~~yp~ 149 (262)
++||+.+ .|+.. +||+|||||||.++ .++|||||||||++|||+||+||.||. |.|||+.+++-+.
T Consensus 300 rgGV~~P~~~~Cs~~~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY~~l~RG~-----N~CGi~~mvss~~ 370 (372)
T KOG1542|consen 300 RGGVSCPSKYICSPKLLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGYYKLCRGS-----NACGIADMVSSAA 370 (372)
T ss_pred cccccCCCcccCCccccCceEEEEeecCCCCCCceEEEECCccccccccceEEEeccc-----cccccccchhhhh
Confidence 9999987 68765 79999999999987 899999999999999999999999994 5799998876543
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >KOG4296 consensus Epithelin/granulin [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] | Back alignment and domain information |
|---|
| >smart00277 GRAN Granulin | Back alignment and domain information |
|---|
| >PF00396 Granulin: Granulin; InterPro: IPR000118 Metazoan granulins [] are a family of cysteine-rich peptides of about 6 Kd which may have multiple biological activity | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
| >COG4990 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 262 | ||||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 3e-50 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 5e-48 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 7e-48 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 5e-47 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 7e-47 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 6e-46 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 1e-45 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 2e-44 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 8e-38 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 2e-36 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 3e-35 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 9e-34 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 9e-33 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 1e-30 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 4e-30 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 4e-30 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 5e-30 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 5e-30 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 6e-30 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 6e-30 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 6e-30 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 6e-30 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 6e-30 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 6e-30 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 7e-30 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 9e-30 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 1e-29 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 2e-29 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 2e-28 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 6e-28 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 7e-28 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 7e-28 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 7e-28 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 7e-28 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 8e-28 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 8e-28 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 1e-27 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 1e-27 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 2e-27 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 3e-27 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 5e-27 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 6e-27 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 6e-27 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 8e-27 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 9e-27 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 1e-26 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 2e-26 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 2e-26 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 2e-26 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 2e-26 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 2e-26 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 9e-26 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 1e-25 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 3e-25 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 6e-25 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 9e-25 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 1e-24 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 1e-24 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 4e-24 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 4e-24 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 4e-24 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 6e-24 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 9e-23 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 9e-23 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 9e-23 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 2e-20 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 4e-18 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 5e-18 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 5e-18 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 1e-17 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 1e-17 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 1e-17 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 1e-17 | ||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 4e-17 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 6e-17 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 8e-17 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 2e-16 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 2e-12 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 2e-10 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 2e-10 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 9e-10 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 9e-10 | ||
| 2as8_A | 222 | Crystal Structure Of Mature And Fully Active Der P | 2e-09 | ||
| 3rvw_A | 222 | Crystal Structure Of Der P 1 Complexed With Fab 4c1 | 2e-09 | ||
| 3f5v_A | 222 | C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 | 2e-09 | ||
| 1xkg_A | 312 | Crystal Structure Of The Major House Dust Mite Alle | 4e-09 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 7e-09 | ||
| 1k3b_C | 69 | Crystal Structure Of Human Dipeptidyl Peptidase I ( | 1e-08 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 3e-08 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 3e-08 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 4e-08 | ||
| 1pbh_A | 317 | Crystal Structure Of Human Recombinant Procathepsin | 4e-08 | ||
| 3ai8_B | 256 | Cathepsin B In Complex With The Nitroxoline Length | 5e-08 | ||
| 3k9m_A | 254 | Cathepsin B In Complex With Stefin A Length = 254 | 5e-08 | ||
| 3cbj_A | 266 | Chagasin-cathepsin B Complex Length = 266 | 5e-08 | ||
| 1gmy_A | 261 | Cathepsin B Complexed With Dipeptidyl Nitrile Inhib | 5e-08 | ||
| 1huc_B | 205 | The Refined 2.15 Angstroms X-Ray Crystal Structure | 7e-08 | ||
| 1mir_A | 322 | Rat Procathepsin B Length = 322 | 2e-07 | ||
| 1cpj_A | 260 | Crystal Structures Of Recombinant Rat Cathepsin B A | 2e-07 | ||
| 1cte_A | 254 | Crystal Structures Of Recombinant Rat Cathepsin B A | 3e-07 | ||
| 4hwy_A | 340 | Trypanosoma Brucei Procathepsin B Solved From 40 Fs | 4e-07 | ||
| 3mor_A | 317 | Crystal Structure Of Cathepsin B From Trypanosoma B | 5e-07 | ||
| 3hhi_A | 325 | Crystal Structure Of Cathepsin B From T. Brucei In | 5e-07 | ||
| 2jyt_A | 69 | Human Granulin C, Isomer 1 Length = 69 | 3e-06 | ||
| 2jye_A | 72 | Human Granulin A Length = 72 | 3e-06 | ||
| 2jyv_A | 72 | Human Granulin F Length = 72 | 7e-05 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 9e-05 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 9e-05 | ||
| 1icf_B | 42 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 2e-04 |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
|
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 | Back alignment and structure |
| >pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 | Back alignment and structure |
| >pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 | Back alignment and structure |
| >pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 | Back alignment and structure |
| >pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 | Back alignment and structure |
| >pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 | Back alignment and structure |
| >pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 | Back alignment and structure |
| >pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 | Back alignment and structure |
| >pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 | Back alignment and structure |
| >pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 | Back alignment and structure |
| >pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 | Back alignment and structure |
| >pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 | Back alignment and structure |
| >pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 | Back alignment and structure |
| >pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 | Back alignment and structure |
| >pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 | Back alignment and structure |
| >pdb|2JYT|A Chain A, Human Granulin C, Isomer 1 Length = 69 | Back alignment and structure |
| >pdb|2JYE|A Chain A, Human Granulin A Length = 72 | Back alignment and structure |
| >pdb|2JYV|A Chain A, Human Granulin F Length = 72 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|1ICF|B Chain B, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 42 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
Score = 282 bits (724), Expect = 5e-97
Identities = 94/152 (61%), Positives = 115/152 (75%), Gaps = 2/152 (1%)
Query: 1 MDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVA 60
M F+FII+NGGI+TE +YPY A +G C+ + K V+ID YE+VP N+E ALQ AVA
Sbjct: 70 MTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVA 129
Query: 61 NQPVSVAIEGGGMAFQLYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWG 120
QPVSVA+E G FQ Y SGIFTG CGT++DH VT VGYGTE G DYWIVKNSWG++WG
Sbjct: 130 YQPVSVALEAAGYNFQHYSSGIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWG 189
Query: 121 EAGYIRMERNVAGTLTGKCGIAMEASYPIKKG 152
E GY+R++RNV G G+CGIA +ASYP+K
Sbjct: 190 EEGYMRIQRNVGG--VGQCGIAKKASYPVKYY 219
|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >2jye_A Granulin A; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2jyt_A Granulin-5, granulin C; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} PDB: 2jyu_A Length = 69 | Back alignment and structure |
|---|
| >2jyv_A Granulin-2, granulin F; granulin C, epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1fwo_A Oryzain beta chain; beta-hairpin stack fold, granulin/epithelin-like protein repeats, hydrolase; NMR {Synthetic} SCOP: g.3.16.1 Length = 35 | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 262 | |||
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 99.97 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 99.97 | |
| 2jye_A | 72 | Granulin A; epithelin, human, stack of hairpins, a | 99.93 | |
| 2jyv_A | 72 | Granulin-2, granulin F; granulin C, epithelin, hum | 99.9 | |
| 2jyt_A | 69 | Granulin-5, granulin C; epithelin, human, stack of | 99.89 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.88 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.81 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.58 | |
| 1fwo_A | 35 | Oryzain beta chain; beta-hairpin stack fold, granu | 99.39 | |
| 1i8x_A | 30 | Granulin-1; two beta-hairpin stack, cytokine; NMR | 99.19 | |
| 1g26_A | 31 | Granulin A, HGA; granulin/epithelin protein repeat | 99.17 | |
| 3erv_A | 236 | Putative C39-like peptidase; structural genomics, | 91.63 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 87.73 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 83.78 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 82.47 |
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.2e-43 Score=306.14 Aligned_cols=149 Identities=63% Similarity=1.145 Sum_probs=134.0
Q ss_pred ChHHHHHHHHcCCCCCCCCCCcccCCCCccCCCCCceEEEEeeeeeCCCchHHHHHHHHHcCCeEEEEeccccccccccC
Q 024815 1 MDYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYES 80 (262)
Q Consensus 1 ~~~A~~yl~~~gGi~~E~~YPY~~~~~~C~~~~~~~~~~~i~~y~~v~~~~~~~lk~al~~GPV~v~i~a~~~~f~~Y~s 80 (262)
+..||+|+++++||++|++|||.+.++.|.........++|++|..++.+++++|+++|++|||+++|++...+|++|++
T Consensus 70 ~~~a~~~~~~~~Gi~~e~~yPY~~~~~~C~~~~~~~~~~~i~~~~~v~~~~~~~l~~~l~~GPV~v~~~~~~~~f~~Y~~ 149 (220)
T 3p5u_A 70 MTDGFQFIINNGGINTEANYPYTAEEGQCNLDLQQEKYVSIDTYENVPYNNEWALQTAVAYQPVSVALEAAGYNFQHYSS 149 (220)
T ss_dssp HHHHHHHHHHHTCBCBTTTSCCCSSCCCCCHHHHTCCSBCCCEEEECCTTCHHHHHHHHTTSCEEEEECCCSHHHHTCCS
T ss_pred HHHHHHHHHHhCCcCcccccccccCCCCcCcCCCCCceEEEccEEEeCCCcHHHHHHHHhcCCEEEEEecCchhhccccC
Confidence 35899999988899999999999999999754434445789999999888899999999889999999997678999999
Q ss_pred cEEeccCCCCCCeEEEEEEeeeeCCeEEEEEECCCCCCCCCCceEEEecccCCCccCceeeeceecceeec
Q 024815 81 GIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKK 151 (262)
Q Consensus 81 GIy~~~c~~~~~HaVliVGYg~~~G~~YWIVkNSWGt~WGe~GY~rI~rg~~~~~~g~CgI~~~~~yp~~~ 151 (262)
|||+..|...++|||+|||||+++|++|||||||||++|||+|||||+|+.++ .|+|||++.++||+.+
T Consensus 150 Giy~~~~~~~~~HaV~iVGyg~~~g~~yWivkNSWG~~WGe~Gy~~i~r~~~~--~~~Cgi~~~~~~p~~~ 218 (220)
T 3p5u_A 150 GIFTGPCGTAVDHAVTIVGYGTEGGIDYWIVKNSWGTTWGEEGYMRIQRNVGG--VGQCGIAKKASYPVKY 218 (220)
T ss_dssp SEECCCCCCSCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECCCCT--TCGGGTTSSCEEEECS
T ss_pred ceECCCCCCccceEEEEEEEecCCCceEEEEECCCCCCcccCCEEEEECCCCC--CCccCcccccceEEEe
Confidence 99988888888999999999999999999999999999999999999999763 5799999999999865
|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2jye_A Granulin A; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jyv_A Granulin-2, granulin F; granulin C, epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jyt_A Granulin-5, granulin C; epithelin, human, stack of hairpins, alternative splicing, cytokine, glycoprotein, polymorphism, secreted; NMR {Homo sapiens} PDB: 2jyu_A | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1fwo_A Oryzain beta chain; beta-hairpin stack fold, granulin/epithelin-like protein repeats, hydrolase; NMR {Synthetic} SCOP: g.3.16.1 | Back alignment and structure |
|---|
| >1i8x_A Granulin-1; two beta-hairpin stack, cytokine; NMR {Synthetic} SCOP: g.3.16.1 PDB: 1qgm_A 1i8y_A | Back alignment and structure |
|---|
| >1g26_A Granulin A, HGA; granulin/epithelin protein repeats, beta-hairpin stack, cytokine; NMR {Synthetic} SCOP: g.3.16.1 | Back alignment and structure |
|---|
| >3erv_A Putative C39-like peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 262 | ||||
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 5e-36 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 9e-35 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 2e-34 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 5e-32 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 5e-32 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 4e-31 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 3e-29 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 1e-28 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 3e-28 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 6e-28 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 1e-27 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 6e-27 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 6e-27 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 1e-26 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 2e-26 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 4e-26 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 2e-25 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 6e-25 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 4e-23 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 8e-21 | |
| d1fwoa_ | 35 | g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sati | 4e-16 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 2e-07 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 6e-06 | |
| d1g26a_ | 31 | g.3.16.1 (A:) N-terminal domain of granulin-1 {Hum | 8e-04 |
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Chymopapain species: Papaya (Carica papaya) [TaxId: 3649]
Score = 125 bits (315), Expect = 5e-36
Identities = 67/135 (49%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
Query: 17 EEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQ 76
+ YPY+A C K V I Y+ VP N E + A+ANQP+SV +E GG FQ
Sbjct: 83 SKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNCETSFLGALANQPLSVLVEAGGKPFQ 142
Query: 77 LYESGIFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLT 136
LY+SG+F G CGT LDH VTAVGYGT +G +Y I+KNSWG +WGE GY+R++R G
Sbjct: 143 LYKSGVFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQS-GNSQ 201
Query: 137 GKCGIAMEASYPIKK 151
G CG+ + YP K
Sbjct: 202 GTCGVYKSSYYPFKG 216
|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1fwoa_ g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sativa) [TaxId: 4530]} Length = 35 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
| >d1g26a_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 262 | |||
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 100.0 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 99.98 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 99.98 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 99.98 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 99.98 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 99.97 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 99.97 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 99.97 | |
| d1fwoa_ | 35 | Oryzain beta chain {Rice (Oryza sativa) [TaxId: 45 | 99.34 | |
| d1g26a_ | 31 | N-terminal domain of granulin-1 {Human (Homo sapie | 99.14 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.11 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 98.83 | |
| d1i8ya_ | 28 | N-terminal domain of granulin-1 {Carp (Cyprinus ca | 98.5 |
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: Chymopapain species: Papaya (Carica papaya) [TaxId: 3649]
Probab=100.00 E-value=1.9e-37 Score=266.44 Aligned_cols=148 Identities=47% Similarity=0.918 Sum_probs=129.5
Q ss_pred hHHHHHHHHcCCCCCCCCCCcccCCCCccCCCCCceEEEEeeeeeCCCchHHHHHHHHHcCCeEEEEeccccccccccCc
Q 024815 2 DYAFEFIIDNGGIDTEEDYPYKAIDGSCDTYRKNAKVVTIDDYEDVPLNDEKALQKAVANQPVSVAIEGGGMAFQLYESG 81 (262)
Q Consensus 2 ~~A~~yl~~~gGi~~E~~YPY~~~~~~C~~~~~~~~~~~i~~y~~v~~~~~~~lk~al~~GPV~v~i~a~~~~f~~Y~sG 81 (262)
..|+.|+++. |+++|++|||...+..+...........+..+..+..+++++|+++|.+|||++++.+..++|+.|++|
T Consensus 69 ~~~~~~~~~~-g~~~e~~~py~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pv~~~~~~~~~~~~~y~~G 147 (218)
T d1yala_ 69 TTSLQYVANN-GVHTSKVYPYQAKQYKCRATDKPGPKVKITGYKRVPSNCETSFLGALANQPLSVLVEAGGKPFQLYKSG 147 (218)
T ss_dssp HHHHHHHHHH-CBCBTTTSCCCSSCCCCCGGGCCSCCBCCSEEEECCSSBHHHHHHHHTTSCEEEEECCCSHHHHTCCSS
T ss_pred chhhhhhhhh-cccccccCCcccccCccccccccccceeeccceEeCCccHHHHHHHHHhCCceEEEEecccchhhcccc
Confidence 4689998877 899999999998876554433444556777888888888888999999999999999987789999999
Q ss_pred EEeccCCCCCCeEEEEEEeeeeCCeEEEEEECCCCCCCCCCceEEEecccCCCccCceeeeceecceeec
Q 024815 82 IFTGRCGTSLDHGVTAVGYGTENGADYWIVKNSWGSSWGEAGYIRMERNVAGTLTGKCGIAMEASYPIKK 151 (262)
Q Consensus 82 Iy~~~c~~~~~HaVliVGYg~~~G~~YWIVkNSWGt~WGe~GY~rI~rg~~~~~~g~CgI~~~~~yp~~~ 151 (262)
||...+....+|||+|||||++++++|||||||||++|||+|||||+|+.++. .+.|||++.++||++.
T Consensus 148 iy~~~~~~~~~Hav~IVGyg~~~g~~ywivkNSWG~~WGd~Gy~~I~~~~~~~-~~~CGI~~~~~~p~~~ 216 (218)
T d1yala_ 148 VFDGPCGTKLDHAVTAVGYGTSDGKNYIIIKNSWGPNWGEKGYMRLKRQSGNS-QGTCGVYKSSYYPFKG 216 (218)
T ss_dssp EECCSCCSCCCEEEEEEEEEEETTEEEEEEECSBCTTSTBTTEEEEECCCSBS-CCGGGTTSSCEEEECC
T ss_pred eeeecccccCCcEEEEEEeeccCCceEEEEECCCCCCcccCCEEEEEccCCCC-CCcCCccceeeeccCC
Confidence 99887777789999999999999999999999999999999999999998764 7899999999999864
|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fwoa_ g.3.16.1 (A:) Oryzain beta chain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1g26a_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8ya_ g.3.16.1 (A:) N-terminal domain of granulin-1 {Carp (Cyprinus carpio) [TaxId: 7962]} | Back information, alignment and structure |
|---|