Citrus Sinensis ID: 024860

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRNSITNTNGAKDTPKRKDPEIYNHDDTEANPVQESNLVDIIPPILESSSSSSDQISSLSMTTDITSVGKNTNTTDELILDNNNEVVFHPYADTSGSFWTEPFYSDNFYNLYISNDFQAPSLLPADPGFASVHSPFLDGEIILWP
ccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHccccHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccHHcccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mvrtpccdktglkkgtwtpeeDRKLIAYVTKYGywnwrqlpkyaglarcgkSCRLRWMNylrpnikrgnytkeeEDTIIRLHESLGNRWSAIAaqlpgrtdneiknHWHTSLKKRLKRnsitntngakdtpkrkdpeiynhddteanpvqesnlvdiippilessssssdqisslsmttditsvgkntnttdelildnnnevvfhpyadtsgsfwtepfysdnfynlyisndfqapsllpadpgfasvhspfldgeiilwp
mvrtpccdktglkkgtwtpeedrKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNylrpnikrgnytkeEEDTIIRLHESLGNRWSAIAAQlpgrtdneikNHWHTslkkrlkrnsitntngakdtpkrkdpEIYNHDdteanpvqesnLVDIIPPILESSSSSSDQISSLSMTTDITSVGKNTNTTDELILDNNNEVVFHPYADTSGSFWTEPFYSDNFYNLYISNDFQAPSLLPADPGFASVHSPFLDGEIILWP
MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRNSITNTNGAKDTPKRKDPEIYNHDDTEANPVQESNLVdiippilessssssdqisslsMTTDITSVGKNTNTTDELILDNNNEVVFHPYADTSGSFWTEPFYSDNFYNLYISNDFQAPSLLPADPGFASVHSPFLDGEIILWP
**********GLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGR****IKNHW**********************************************************************************TDELILDNNNEVVFHPYADTSGSFWTEPFYSDNFYNLYISNDFQAPSLLPADPGFASVHSPFLDGEIILW*
**RTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKK**************************************************************************************************SFWTEPFYSDNFYNL************************FLDGEIILWP
MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRNSITNTNGAKDTPKRKDPEIYNHDDTEANPVQESNLVDIIPPILES***********SMTTDITSVGKNTNTTDELILDNNNEVVFHPYADTSGSFWTEPFYSDNFYNLYISNDFQAPSLLPADPGFASVHSPFLDGEIILWP
***TPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRN**********************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRNSITNTNGAKDTPKRKDPEIYNHDDTEANPVQESNLVDIIPPILESSSSSSDQISSLSMTTDITSVGKNTNTTDELILDNNNEVVFHPYADTSGSFWTEPFYSDNFYNLYISNDFQAPSLLPADPGFASVHSPFLDGEIILWP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query261 2.2.26 [Sep-21-2011]
Q7XBH4257 Myb-related protein Myb4 yes no 0.444 0.451 0.767 2e-51
P20024340 Myb-related protein Zm1 O N/A no 0.444 0.341 0.689 5e-46
Q8GWP0360 Transcription factor MYB3 no no 0.463 0.336 0.647 2e-44
P80073 421 Myb-related protein Pp2 O N/A no 0.463 0.287 0.628 1e-43
Q50EX6294 Protein ODORANT1 OS=Petun N/A no 0.758 0.673 0.456 1e-43
Q38850249 Transcription repressor M no no 0.452 0.473 0.644 1e-42
Q8LPH6352 Transcription factor MYB8 no no 0.463 0.343 0.611 1e-42
Q9SZP1282 Transcription repressor M no no 0.586 0.542 0.494 1e-42
P27898 399 Myb-related protein P OS= N/A no 0.498 0.325 0.607 2e-42
Q9SPG2 366 Transcription factor MYB2 no no 0.540 0.385 0.532 2e-42
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function desciption
 Score =  202 bits (514), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 89/116 (76%), Positives = 102/116 (87%)

Query: 1   MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNY 60
           M R PCC+K GLKKG WTPEED+ L+A++ ++G+ NWR LPK AGL RCGKSCRLRW+NY
Sbjct: 1   MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINY 60

Query: 61  LRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRL 116
           LRP+IKRGN++KEEEDTII LHE LGNRWSAIAA+LPGRTDNEIKN WHT LKKRL
Sbjct: 61  LRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRL 116
Putative transcription factor which is may be involved in cold stress response.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function description
>sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 Back     alignment and function description
>sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 Back     alignment and function description
>sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
224126823256 predicted protein [Populus trichocarpa] 0.923 0.941 0.564 7e-74
224145547250 predicted protein [Populus trichocarpa] 0.904 0.944 0.572 7e-71
147837078284 hypothetical protein VITISV_019320 [Viti 0.923 0.848 0.540 9e-66
225447697257 PREDICTED: myb-related protein Myb4 [Vit 0.923 0.937 0.540 2e-65
302398929253 MYB domain class transcription factor [M 0.885 0.913 0.513 4e-60
356547038227 PREDICTED: myb-related protein Myb4-like 0.766 0.881 0.528 1e-59
356515230324 PREDICTED: transcription repressor MYB6- 0.517 0.416 0.740 4e-58
356544870305 PREDICTED: transcription repressor MYB4 0.521 0.445 0.735 7e-58
356515228318 PREDICTED: transcription repressor MYB4 0.827 0.679 0.532 1e-57
15229407285 myb domain protein 15 [Arabidopsis thali 0.961 0.880 0.469 9e-57
>gi|224126823|ref|XP_002319935.1| predicted protein [Populus trichocarpa] gi|222858311|gb|EEE95858.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  283 bits (723), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 173/257 (67%), Gaps = 16/257 (6%)

Query: 1   MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNY 60
           MVRTPCCDKTGLKKG WTPEEDRKL+AYVT+YG WNWRQLPK+AGL RCGKSCRLRW+NY
Sbjct: 1   MVRTPCCDKTGLKKGAWTPEEDRKLMAYVTRYGCWNWRQLPKFAGLQRCGKSCRLRWLNY 60

Query: 61  LRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRNS 120
           LRPNIKRGNY+KEEE+TII LHE++GNRWSAIAAQLPGRTDNEIKNHWHT+LKKRL++ S
Sbjct: 61  LRPNIKRGNYSKEEEETIISLHETMGNRWSAIAAQLPGRTDNEIKNHWHTNLKKRLRKKS 120

Query: 121 ITNTNGAKDTPKRKDPEIYNHDDTEANPVQESNLVDIIPPILESSSSSSDQISSLSMTTD 180
           +               +     DTE   +   N       I   SS+ S Q SS    +D
Sbjct: 121 VLEAKEMSSDDDLSQDDKNQEKDTEETDISTQNPATSNEIIESPSSTMSPQASS----SD 176

Query: 181 ITSVGKNTNTTDELILDNNNEVVFHPYADTSGSFWTEPFYSDNFYNLYISNDFQAPSLLP 240
           I+++  N   TD  ++ +NN      Y   SG+FWTEPF SD++   ++ NDF AP + P
Sbjct: 177 ISTID-NVAATDWDLISDNNFAFLEAYEAPSGNFWTEPFLSDDY---FMPNDFMAPLVDP 232

Query: 241 ADPGFASVHSPFLDGEI 257
                    SPF DGE 
Sbjct: 233 --------DSPFFDGEF 241

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224145547|ref|XP_002325681.1| predicted protein [Populus trichocarpa] gi|222862556|gb|EEF00063.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147837078|emb|CAN72480.1| hypothetical protein VITISV_019320 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447697|ref|XP_002272704.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera] gi|296081257|emb|CBI18001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302398929|gb|ADL36759.1| MYB domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|356547038|ref|XP_003541925.1| PREDICTED: myb-related protein Myb4-like [Glycine max] Back     alignment and taxonomy information
>gi|356515230|ref|XP_003526304.1| PREDICTED: transcription repressor MYB6-like [Glycine max] Back     alignment and taxonomy information
>gi|356544870|ref|XP_003540870.1| PREDICTED: transcription repressor MYB4 [Glycine max] Back     alignment and taxonomy information
>gi|356515228|ref|XP_003526303.1| PREDICTED: transcription repressor MYB4 [Glycine max] Back     alignment and taxonomy information
>gi|15229407|ref|NP_188966.1| myb domain protein 15 [Arabidopsis thaliana] gi|7939535|dbj|BAA95738.1| myb-related transcription factor [Arabidopsis thaliana] gi|45357096|gb|AAS58507.1| MYB transcription factor [Arabidopsis thaliana] gi|51971431|dbj|BAD44380.1| putative myb-related transcription factor [Arabidopsis thaliana] gi|51971583|dbj|BAD44456.1| putative myb-related transcription factor [Arabidopsis thaliana] gi|109946447|gb|ABG48402.1| At3g23250 [Arabidopsis thaliana] gi|332643219|gb|AEE76740.1| myb domain protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
TAIR|locus:2086233285 MYB15 "myb domain protein 15" 0.977 0.894 0.439 3e-53
TAIR|locus:2141231350 MYB102 "MYB-like 102" [Arabido 0.463 0.345 0.694 4.1e-52
TAIR|locus:2042526249 MYB14 "myb domain protein 14" 0.490 0.514 0.713 3.2e-49
TAIR|locus:2075387321 MYB107 "myb domain protein 107 0.444 0.361 0.698 2e-47
TAIR|locus:2207330294 MYB63 "myb domain protein 63" 0.563 0.5 0.6 3.3e-47
TAIR|locus:2115708324 MYB74 "myb domain protein 74" 0.463 0.373 0.688 4.2e-47
TAIR|locus:2038520246 MYB13 "myb domain protein 13" 0.471 0.5 0.715 3e-46
TAIR|locus:2032860274 MYB58 "myb domain protein 58" 0.547 0.521 0.606 7.9e-46
TAIR|locus:2132957282 MYB41 "myb domain protein 41" 0.463 0.429 0.694 2.7e-45
TAIR|locus:2102152388 MYB106 "myb domain protein 106 0.463 0.311 0.685 4.4e-45
TAIR|locus:2086233 MYB15 "myb domain protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 551 (199.0 bits), Expect = 3.0e-53, P = 3.0e-53
 Identities = 120/273 (43%), Positives = 155/273 (56%)

Query:     1 MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNY 60
             M R PCC+K GLK+G WTPEED+ L++++  +G+ NWR LPK AGL RCGKSCRLRWMNY
Sbjct:     1 MGRAPCCEKMGLKRGPWTPEEDQILVSFILNHGHSNWRALPKQAGLLRCGKSCRLRWMNY 60

Query:    61 LRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLK--R 118
             L+P+IKRGN+TKEEED II LH+ LGNRWSAIAA+LPGRTDNEIKN WHT LKKRL+  +
Sbjct:    61 LKPDIKRGNFTKEEEDAIISLHQILGNRWSAIAAKLPGRTDNEIKNVWHTHLKKRLEDYQ 120

Query:   119 NSITNTNGAKDTPKRKDPEIYNHDDTEANPVQ-ESNLVXXXXXXXXXXXXXXXXXXXXXM 177
              +   T+  K   K K   +     T +N  + ES L                       
Sbjct:   121 PAKPKTSNKKKGTKPKSESVI----TSSNSTRSESELADSSNPSGESLFSTSPSTSEVSS 176

Query:   178 TTDITSVGKNT-----NTTDELILDNNNEVVFHPY-ADTSGSFWTEPFYSDNFYNLYISN 231
              T I+  G +      N   ++   +   V F  + AD   SFW E  YS + +N Y+SN
Sbjct:   177 MTLISHDGYSNEINMDNKPGDISTIDQECVSFETFGADIDESFWKETLYSQDEHN-YVSN 235

Query:   232 DFQAPSLLPADPGFASVHSP----FLDGEIILW 260
             D +   L+     F ++ S       D E+  W
Sbjct:   236 DLEVAGLVEIQQEFQNLGSANNEMIFDSEMDFW 268
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP;RCA
GO:0009733 "response to auxin stimulus" evidence=IEP;RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP;RCA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0010200 "response to chitin" evidence=IEP;RCA
GO:0002679 "respiratory burst involved in defense response" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0052542 "defense response by callose deposition" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042526 MYB14 "myb domain protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207330 MYB63 "myb domain protein 63" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038520 MYB13 "myb domain protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032860 MYB58 "myb domain protein 58" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132957 MYB41 "myb domain protein 41" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102152 MYB106 "myb domain protein 106" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7XBH4MYB4_ORYSJNo assigned EC number0.76720.44440.4513yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00029221001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (257 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 3e-56
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 8e-53
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 2e-16
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 8e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 8e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 6e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 3e-08
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 0.003
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  186 bits (473), Expect = 3e-56
 Identities = 91/208 (43%), Positives = 126/208 (60%), Gaps = 9/208 (4%)

Query: 1   MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNY 60
           M R  CC K  L+KG W+PEED KL+ ++TKYG+  W  +PK AGL RCGKSCRLRW+NY
Sbjct: 1   MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINY 60

Query: 61  LRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRNS 120
           LRP++KRG ++++EE+ II LH  LGNRWS IAAQLPGRTDNEIKN W++ LKK+L++  
Sbjct: 61  LRPDLKRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRG 120

Query: 121 IT-NTNG----AKDTPKRKDPEIYNHDDTEANPVQESNLVDII----PPILESSSSSSDQ 171
           I  NT+      ++   +  P     D   +    E NL+          L+   SSS  
Sbjct: 121 IDPNTHKPLSEVENGEDKNPPTDDKSDKASSVVSNELNLLKADNSKPLAALQEKRSSSIS 180

Query: 172 ISSLSMTTDITSVGKNTNTTDELILDNN 199
            +   +  + +S  K  N+ +    ++N
Sbjct: 181 PAGYQLEVESSSSSKINNSNNNNHSNSN 208

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 261
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.84
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.8
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.75
PLN03212249 Transcription repressor MYB5; Provisional 99.74
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.68
PLN03091 459 hypothetical protein; Provisional 99.66
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.61
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.57
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.48
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.47
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.45
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.44
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.26
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.14
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.13
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.08
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.97
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.09
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.0
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.97
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.91
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.75
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.67
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.51
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.37
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.34
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.32
KOG1279506 consensus Chromatin remodeling factor subunit and 97.11
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.07
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.93
KOG1279506 consensus Chromatin remodeling factor subunit and 96.88
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.56
PRK13923170 putative spore coat protein regulator protein YlbO 96.28
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.25
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.14
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.12
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.08
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.0
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.66
PRK13923170 putative spore coat protein regulator protein YlbO 95.42
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.11
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 93.85
KOG4282345 consensus Transcription factor GT-2 and related pr 93.28
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.43
KOG2656 445 consensus DNA methyltransferase 1-associated prote 90.2
KOG4282345 consensus Transcription factor GT-2 and related pr 85.68
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 84.9
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 83.72
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 83.69
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.2e-39  Score=279.86  Aligned_cols=121  Identities=63%  Similarity=1.172  Sum_probs=116.4

Q ss_pred             CCCCCCCCCCCcCCCCHHHHHHHHHHHHHhCCCCcccccccccccccccccccccccccCCCCccCCCCHHHHHHHHHHH
Q 024860            3 RTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLH   82 (261)
Q Consensus         3 r~p~~~k~~lkk~~WT~eED~~L~~~V~~~g~~~W~~Ia~~~~~~R~~~qcr~Rw~~~L~p~i~k~~WT~EED~~L~~~~   82 (261)
                      ++|||.|+++++++||+|||++|+++|++||..+|..||+.++.+|+++|||+||.++|+|.+++++||.|||++|++++
T Consensus        14 ~~pcc~K~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lLlel~   93 (249)
T PLN03212         14 TTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLH   93 (249)
T ss_pred             CCCCcccCCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHHHHHH
Confidence            67999999999999999999999999999999899999999977999999999999999999999999999999999999


Q ss_pred             HhcCCchhHhhhcCCCCCHHHHHHHHHHhhhhhhhhCCCCC
Q 024860           83 ESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRNSITN  123 (261)
Q Consensus        83 ~~~G~~W~~Ia~~l~gRt~~~~r~Rw~~~lk~~~k~~~~s~  123 (261)
                      .+||++|+.||+.|+|||+++||+||+.+|++++.+.....
T Consensus        94 ~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i~p  134 (249)
T PLN03212         94 RLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDP  134 (249)
T ss_pred             HhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCCCC
Confidence            99999999999999999999999999999999988876554

>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 1e-24
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 4e-24
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-23
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-23
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-04
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-23
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-04
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 6e-18
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 5e-12
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-10
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 5e-10
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 3e-09
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 9e-07
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 2e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 2e-06
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 72/105 (68%), Gaps = 1/105 (0%)
Query: 12  LKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYT 71
           L KG WT EED+K+I  V KYG   W  + K+    R GK CR RW N+L P +K+ ++T
Sbjct: 5   LVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLK-GRLGKQCRERWHNHLNPEVKKSSWT 63
Query: 72  KEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRL 116
           +EE+  I   H+ LGNRW+ IA  LPGRTDN +KNHW++++K+++
Sbjct: 64  EEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 1e-69
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 5e-69
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-68
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 2e-19
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 6e-60
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-57
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-37
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 9e-57
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 7e-27
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-24
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-08
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 4e-20
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 2e-08
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-15
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 5e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-10
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 3e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-10
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 7e-10
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 2e-08
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 7e-08
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 7e-08
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 3e-05
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-07
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 2e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 7e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 3e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-04
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 9e-06
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 5e-07
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-06
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-05
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 3e-05
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 3e-05
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 1e-04
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 1e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  209 bits (534), Expect = 1e-69
 Identities = 48/124 (38%), Positives = 70/124 (56%), Gaps = 1/124 (0%)

Query: 14  KGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKE 73
           KG +T  ED  +  YV + G  NW ++  +    R  K CR RW N+L P + +  +T E
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQNWPRITSFLPN-RSPKQCRERWFNHLDPAVVKHAWTPE 60

Query: 74  EEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHTSLKKRLKRNSITNTNGAKDTPKR 133
           E++TI R +  LG++WS IA  +PGRTDN IKN W++S+ KR+  NS        D  K+
Sbjct: 61  EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKK 120

Query: 134 KDPE 137
           +   
Sbjct: 121 RKAA 124
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.93
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.86
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.78
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.77
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.77
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.76
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.74
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.74
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.73
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.73
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.72
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.72
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.71
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.71
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.71
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.7
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.7
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.69
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.69
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.69
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.68
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.65
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.65
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.64
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.64
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.64
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.63
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.59
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.58
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.58
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.58
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.57
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.32
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.52
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.46
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.46
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.46
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.44
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.44
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.41
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.41
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.4
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.4
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.4
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.37
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.04
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.35
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.34
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.25
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.02
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.02
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.95
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.87
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.86
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.78
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.72
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.67
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.58
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.56
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.54
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.47
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.4
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.35
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.09
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.09
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.02
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.98
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.97
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.21
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.82
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.7
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.54
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.51
2crg_A70 Metastasis associated protein MTA3; transcription 97.44
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.35
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.29
2crg_A70 Metastasis associated protein MTA3; transcription 97.18
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.13
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.96
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.87
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.86
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.7
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.6
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.06
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.87
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.55
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.99
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 91.31
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 89.37
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 88.79
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=5.3e-37  Score=255.65  Aligned_cols=138  Identities=36%  Similarity=0.636  Sum_probs=91.7

Q ss_pred             CCCcCCCCHHHHHHHHHHHHHhCCCCcccccccccccccccccccccccccCCCCccCCCCHHHHHHHHHHHHhcCC-ch
Q 024860           11 GLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESLGN-RW   89 (261)
Q Consensus        11 ~lkk~~WT~eED~~L~~~V~~~g~~~W~~Ia~~~~~~R~~~qcr~Rw~~~L~p~i~k~~WT~EED~~L~~~~~~~G~-~W   89 (261)
                      ++++++||+|||++|+++|.+||..+|..||+.|+ +|+++||++||.++|+|.+++++||+|||++|+++|.+||. +|
T Consensus         3 ~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W   81 (159)
T 1h89_C            3 HLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLP-NRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRW   81 (159)
T ss_dssp             -----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHcC-CCCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccH
Confidence            47899999999999999999999889999999998 99999999999999999999999999999999999999995 79


Q ss_pred             hHhhhcCCCCCHHHHHHHHHHhhhhhhhhCCCCC-----------------CCCCCCCCCCCCccccCCCCCCCccc
Q 024860           90 SAIAAQLPGRTDNEIKNHWHTSLKKRLKRNSITN-----------------TNGAKDTPKRKDPEIYNHDDTEANPV  149 (261)
Q Consensus        90 ~~Ia~~l~gRt~~~~r~Rw~~~lk~~~k~~~~s~-----------------~~~~~~~~~r~~~~i~n~~~~~~~~~  149 (261)
                      ..||..|+|||+++|++||.++|.+.+++++|+.                 ..+++.+++|++++++|+|...+++.
T Consensus        82 ~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia~~l~gRt~~~~knr~~~~~r~~  158 (159)
T 1h89_C           82 SVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK  158 (159)
T ss_dssp             HHHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHHTTSTTCCHHHHHHHHHTTTCC-
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHHHHhcc
Confidence            9999999999999999999999999999999997                 45678999999999999998877653
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 261
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-20
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-10
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-18
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-09
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-17
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-13
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 1e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 5e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 9e-16
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 3e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 8e-14
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 7e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 6e-13
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 9e-12
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-12
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-12
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 4e-09
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-11
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 9e-11
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-04
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-07
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 9e-07
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 7e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 79.0 bits (195), Expect = 4e-20
 Identities = 26/52 (50%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 12 LKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYLRP 63
          L KG WT EED++LI  V KYG   W  + K+    R GK CR RW N+L P
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNP 51
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.77
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.76
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.73
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.73
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.71
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.67
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.67
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.63
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.59
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.59
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.59
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.51
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.5
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.5
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.5
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.5
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.42
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.39
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.38
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.37
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.36
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.35
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.27
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.19
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.17
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.0
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.98
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.88
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.1
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.06
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.82
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.76
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.47
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.0
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.97
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.31
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.1
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.58
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 94.44
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 91.6
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 88.44
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.77  E-value=1.4e-21  Score=144.98  Aligned_cols=71  Identities=21%  Similarity=0.260  Sum_probs=65.1

Q ss_pred             cCCCCHHHHHHHHHHHHHhCCC-----CcccccccccccccccccccccccccCCCCccCCCCHHHHHHHHHHHHhc
Q 024860           14 KGTWTPEEDRKLIAYVTKYGYW-----NWRQLPKYAGLARCGKSCRLRWMNYLRPNIKRGNYTKEEEDTIIRLHESL   85 (261)
Q Consensus        14 k~~WT~eED~~L~~~V~~~g~~-----~W~~Ia~~~~~~R~~~qcr~Rw~~~L~p~i~k~~WT~EED~~L~~~~~~~   85 (261)
                      |++||+|||++|+++|.+||..     +|..||+.|+ +||++|||+||.++|+|.++++.||.+||++|+..+..+
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~l   76 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNL   76 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCB
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhcc
Confidence            6889999999999999999874     4999999998 999999999999999999999999999999988665443
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure