Citrus Sinensis ID: 024876


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MEEVDGEPKSQAPGEVGESEIVTEDAAFVRGEPPQDGDGPPKVDSEVEVLHEKVTKQIIKEGHGQKPSKYSTCFLHYRAWAESTRHKFDDTWLEQQPLEMVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVSK
ccccccccccccccccccCEEEECcccccccccccccccccccccEEEEEcccEEEEEEEcccccccccccEEEEEEEEEEccccEEEcccccccccEEEEccccccccHHHHHHHHccccccEEEEEEcccccccccccccccccccccEEEEEEEEEEEECcccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHcc
********************************************SEVEVLHEKVTKQIIKEGHGQKPSKYSTCFLHYRAWAESTRHKFDDTWLEQQPLEMVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGK**S**TVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVSK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEVDGEPKSQAPGEVGESEIVTEDAAFVRGEPPQDGDGPPKVDSEVEVLHEKVTKQIIKEGHGQKPSKYSTCFLHYRAWAESTRHKFDDTWLEQQPLEMVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase FKBP42 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Modulates the uptake of MRP substrates into the vacuole; reduces metolachlor-GS (MOC-GS) and enhances 17-beta-estradiol 17-(beta-D-glucuronide) (E(2)17betaG) uptake. Regulates cell elongation and orientation. Functions as a positive regulator of PGP1-mediated auxin transport. Confers drug modulation of PGP1 efflux activity as interaction with NPA or flavonol quercetin prevents its physical and functional interaction with PGP1. Required for the proper localization of auxin-related ABCB transporters. Plays a role in brassinosteroid (BR) signaling pathway.probableQ9LDC0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IF4, chain A
Confidence level:very confident
Coverage over the Query: 38-261
View the alignment between query and template
View the model in PyMOL