Citrus Sinensis ID: 024881


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MAAAAATYHHLSLSSISQNPISKSETQHFSSPRHSVSIFKPIFISSSLHKSTNVVPIKTHDRRRFTCSNSLSSIPANTSQYEFSDGSAEIELRLQLGSLEIQSSKDIFVDADGTCLTVRVNRSGSFITLIETNQLFDKIKPTETIWYIDEDQLVINLKKQDPELKWPDIVESWESLTAGSMQLLKGTSIFLVGDSTEVNEKVALELAVGLGYTPLSTKELLETFAKQTIDSWMLAEGSDSVVNGECDVLESLIMFEPLLQL
cHHHHHHHHHEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEEEEcccccCCccccEEEEccccEEEEEEcccccEEEEEEccccccccccccEEEEEccccEEEEEECccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHcccccccc
********HHLSLSSISQN*****************SIFKPIFISSS*******V*IK*HDRRRFTC************QYEFSDGSAEIELRLQLGSLEIQSSKDIFVDADGTCLTVRVNRSGSFITLIETNQLFDKIKPTETIWYIDEDQLVINLKKQDPELKWPDIVESWESLTAGSMQLLKGTSIFLVGDSTEVNEKVALELAVGLGYTPLSTKELLETFAKQTIDSWMLAEGSDSVVNGECDVLESLIMFEPLLQL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAAATYHHLSLSSISQNPISKSETQHFSSPRHSVSIFKPIFISSSLHKSTNVVPIKTHDRRRFTCSNSLSSIPANTSQYEFSDGSAEIELRLQLGSLEIQSSKDIFVDADGTCLTVRVNRSGSFITLIETNQLFDKIKPTETIWYIDEDQLVINLKKQDPELKWPDIVESWESLTAGSMQLLKGTSIFLVGDSTEVNEKVALELAVGLGYTPLSTKELLETFAKQTIDSWMLAEGSDSVVNGECDVLESLIMFEPLLQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable inactive shikimate kinase like 2, chloroplastic probableO82290

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X5M, chain A
Confidence level:confident
Coverage over the Query: 77-181
View the alignment between query and template
View the model in PyMOL
Template: 3VAA, chain A
Confidence level:confident
Coverage over the Query: 185-257
View the alignment between query and template
View the model in PyMOL