Citrus Sinensis ID: 024882

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-

MATPSTKPTPLLKDELDIVIPTIRNLDFLEMWRPFFEPYHLIIVQDGDPSKTIKVPDGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPSGKEINALEQHIKNLLSPSTPLFFNTLYDPYREGADFVRGYPFSLREGVHTAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQPIGRYDDMWAGWCMKVLFYCMVYILCFS

cccccccccccccccCEEEEccccccHHHHHHHccccccEEEEEEccccccccccccccccccccHHHHHHHccccccccccccccccEEEEEEECccEEEEEccccccccccccccHHHHHHHHccCCccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEEccccEEcccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccEEEcc

************KDELDIVIPTIRNLDFLEMWRPFFEPYHLIIVQDGDPSKTIKVPDGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPSGKEINALEQHIKNLLSPSTPLFFNTLYDPYREGADFVRGYPFSLREGVHTAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQPIGRYDDMWAGWCMKVLFYCMVYILCFS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-arabinopyranose mutase 1	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides. Catalyzes the interconvertion of UDP-L-arabinopyranose (UDP-Arap) and UDP-L-arabinofuranose (UDP-Araf). Preferentially catalyzes the formation of UDP-Arap from UDP-Araf. At thermodynamic equilibrium in vitro the ratio of the pyranose form over the furanose form is 90:10. Is probably active as heteromer in vivo.	confident	Q8H8T0
UDP-arabinopyranose mutase 2	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides. Catalyzes the interconvertion of UDP-L-arabinopyranose (UDP-Arap) and UDP-L-arabinofuranose (UDP-Araf) in vitro. Preferentially catalyzes the formation of UDP-Arap from UDP-Araf. At thermodynamic equilibrium in vitro the ratio of the pyranose form over the furanose form is 95:5. Is not active on other UDP-sugars (UDP-Gal, UDP-Xyl, UDP-Glc, GDP-Man and GDP-Fuc). Functions redundantly with RGP2 and is essential for proper cell walls and pollen development. Probably involved in the formation of the pectocellulosic cell wall layer intine. Is probably active as heteromer in vivo.	confident	Q9LFW1
UDP-arabinopyranose mutase 1	UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides. Catalyzes the interconvertion of UDP-L-arabinopyranose (UDP-Arap) and UDP-L-arabinofuranose (UDP-Araf) in vitro. Preferentially catalyzes the formation of UDP-Arap from UDP-Araf. At thermodynamic equilibrium in vitro the ratio of the pyranose form over the furanose form is 95:5. Is not active on other UDP-sugars (UDP-Gal, UDP-Xyl, UDP-Glc, GDP-Man and GDP-Fuc). Functions redundantly with RGP2 and is essential for proper cell walls and pollen development. Probably involved in the formation of the pectocellulosic cell wall layer intine. Is probably active as heteromer in vivo.	confident	Q9SRT9

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HG6, chain A
Confidence level:probable
Coverage over the Query: 14-122
View the alignment between query and template
View the model in PyMOL