Citrus Sinensis ID: 024892

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-

MASLQQTATLSLQSNLFPSGRAASRNPLSATIPSGPRRRGAHGIRMSATVATSYAIALVDLAKANNTLESTSADVEKIEKIFSEKQIHEFFVNPTIDIEKKREMVDEICKSSALQPLTGNFLNILIDAKRVDVVKDIVKEFEEVYNKMTNTEMAVVSSVVKLESEHLAQIAKQVQKLTGAKNVRIKTVIDPSLVAGFTIRYGKWGSKLIDMSVKKQLEEIAAQLDLGDVQLALSTWRRMDIRYSYPGLGCSTIRDAKIARR

ccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEcccccEEEEHHHHHHHHHHHHHHcccccEEHEEEEEEccccccccccccccHHHHHHHcc

*******************************************IRMSATVATSYAIALVDLAKANNTLESTSADVEKIEKIFSEKQIHEFFVNPTIDIEKKREMVDEICKSSALQPLTGNFLNILIDAKRVDVVKDIVKEFEEVYNKMTNTEMAVVSSVVKLESEHLAQIAKQVQKLTGAKNVRIKTVIDPSLVAGFTIRYGKWGSKLIDMSVKKQLEEIAAQLDLGDVQLALSTWRRMDIRYSYPGLGCSTIRDAKI***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASLQQTATLSLQSNLFPSGRAASRNPLSATIPSGPRRRGAHGIRMSATVATSYAIALVDxxxxxxxxxxxxxxxxxxxxxFSEKQIHEFFVNPTIDIEKKREMVDEICKSSALQPLTGNFLNILIDAKRVDVVKDIVKEFEEVYNKMTNTEMAVVSSVVKLESEHLAQIAKQVQKLTGAKNVRIKTVIDPSLVAGFTIRYGKWGSKLIDMSVKKQLEEIAAQLDLGDVQLALSTWRRMDIRYSYPGLGCSTIRDAKIARR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP synthase delta chain, chloroplastic	This protein seems to be part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) into CF(1) or is implicated in proton conduction.	probable	Q02758
ATP synthase delta chain, chloroplastic	This protein seems to be part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) into CF(1) or is implicated in proton conduction.	probable	P11402
ATP synthase delta chain, chloroplastic	This protein seems to be part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) into CF(1) or is implicated in proton conduction.	probable	P32980

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSS, chain S
Confidence level:very confident
Coverage over the Query: 48-181,207-223
View the alignment between query and template
View the model in PyMOL