Citrus Sinensis ID: 024897

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-

MAAPSPREENVYMAKLAEQAERYEEMVQYMEKVVASASTGEELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESRGNQDHVSVIKEYRSKIEAELTEICGGILKLLDQKLVPAAAAADSKVFYLKMKGDYHRYLAEFKTGDERKVAAENTLNAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPEEEKKQ

ccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHcccccccHHccc

*********NVYMAKLAEQAERYEEMVQYMEKVVASASTGEELTVEERNLLSVAYKNVIGARRASWRIVSS*************VSVIKEYRSKIEAELTEICGGILKLLDQKLVPAAAAADSKVFYLKMKGDYHRYLAEFKTGDERKVAAENTLNAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEDSYKDSTLIMQLLRDNLTLWT***********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAAPSPREENVYxxxxxxxxxxxxxxxxxxxxxVASASTGEELTVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESRGNQDHVSVIKEYRSKIEAELTEICGGILKLLDQKLVPAAAAADSKVFYLKMKGDYHRYLAEFKTGDERKVAAENTLNAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLGEDSYKDSTLIMQLLRDNLTLWTSDMQDDGTDEIKEAPKPEEEKKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
14-3-3 protein epsilon	Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.	confident	P62260
14-3-3 protein epsilon	Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.	confident	P62258
14-3-3-like protein		confident	P54632

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O9D, chain A
Confidence level:very confident
Coverage over the Query: 4-240
View the alignment between query and template
View the model in PyMOL