Citrus Sinensis ID: 024921


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MENQYLNLLDRALGLDGPSEPWPLSGRVVLIEDCVETSGSFVLHQLVKRSLSPTSSNVIIFVAFANPFSHYDRILRKLGCNLVTQRDNKRFIFFDMLMLRCPDVDEGKSSEGGLVLLYEKILKTICGLPGDKKDYVTIMIDDISLVEVAANGGSDYVLDFLHYCHALTSEFDCSLITLNHEDIYSSMERPTLILQMEYLADILIKAEPLSTGLATDVHGQLTVLNKGTSHRLGRSGNKIHNFHYKVKENTVEYFYPGSRV
cccccHHHHHHHHccccccccccccccEEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEcccHHHHHHHHHHHccccccccccccEEEEEccccccccccccccccccHHHHHHHHHHHHccccccccccEEEEEEccHHHHHHHcccHHHHHHHHHHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHccEEEEEcccccccccccCEEEEEEEcccccccccccccCEEEEEEEEcccEEEEcccccc
*****LNLLDRALGLDGPSEPWPLSGRVVLIEDCVETSGSFVLHQLVKRSLSPTSSNVIIFVAFANPFSHYDRILRKLGCNLVTQRDNKRFIFFDMLMLRCPDVDEGKSSEGGLVLLYEKILKTICGLPGDKKDYVTIMIDDISLVEVAANGGSDYVLDFLHYCHALTSEFDCSLITLNHEDIYSSMERPTLILQMEYLADILIKAEPLSTGLATDVHGQLTVLNKGTSHRLGRSGNKIHNFHYKVKENTVEYFYPGS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENQYLNLLDRALGLDGPSEPWPLSGRVVLIEDCVETSGSFVLHQLVKRSLSPTSSNVIIFVAFANPFSHYDRILRKLGCNLVTQRDNKRFIFFDMLMLRCPDVDEGKSSEGGLVLLYEKILKTICGLPGDKKDYVTIMIDDISLVEVAANGGSDYVLDFLHYCHALTSEFDCSLITLNHEDIYSSMERPTLILQMEYLADILIKAEPLSTGLATDVHGQLTVLNKGTSHRLGRSGNKIHNFHYKVKENTVEYFYPGSRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongator complex protein 6 Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4 (By similarity). Promotes organs development by modulating cell division rate. Involved in oxidative stress signaling. Prevents anthocyanins accumulation.probableQ8L9Y2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A8J, chain C
Confidence level:very confident
Coverage over the Query: 24-256
View the alignment between query and template
View the model in PyMOL
Template: 2DR3, chain A
Confidence level:confident
Coverage over the Query: 7-257
View the alignment between query and template
View the model in PyMOL