Citrus Sinensis ID: 024926


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MHAPSVLVPAFVKAVRDNTEASFRSIMAEPIPGIYTFEMLQPRFCEMLLSEVENFERWVHDTRFRIMRPNTMNKFGAVLDDFGLETMLDKLMNDFIRPISKVFFPEVGGSTLDSHHGFVVEYGMDRDVELGFHVDDSEVTLNVCLGREFSGGELFFRGVRCDKHVNTETQSEEILDYSHVPGYAVLHRGRHRHGARATTSGSRVNLLVWCRSSVFRELKKYQKECSSWCAECQREKKERQCISIAATKQELLKRIGNTSS
ccccccccHHHHHHHHHccHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEccccccccccccccccEEEEEEcccccccccEEEEEEEEcccccccccccccccccccccEEEECcccccccccccccCEEEEEEEEcccccEEHHHHHHHHcccccHHHHccHHHHHHHHHHHHHHHHHHHHccccc
**APSVLVPAFVKAVRDNTEASFRSIMAEPIPGIYTFEMLQPRFCEMLLSEVENFERWVHDTRFRIMRPNTMNKFGAVLDDFGLETMLDKLMNDFIRPISKVFFPEVGGSTLDSHHGFVVEYGMDRDVELGFHVDDSEVTLNVCLGREFSGGELFFRGVRCDKHVNTETQSEEILDYSHVPGYAVLHRGRHRHGARATTSGSRVNLLVWCRSSVFRELKKYQKECSSWCAECQREKKERQCISIAA**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHAPSVLVPAFVKAVRDNTEASFRSIMAEPIPGIYTFEMLQPRFCEMLLSEVENFERWVHDTRFRIMRPNTMNKFGAVLDDFGLETMLDKLMNDFIRPISKVFFPEVGGSTLDSHHGFVVEYGMDRDVELGFHVDDSEVTLNVCLGREFSGGELFFRGVRCDKHVNTETQSEEILDYSHVPGYAVLHRGRHRHGARATTSGSRVNLLVWCRSSVFRExxxxxxxxxxxxxxxxxxxxxRQCISIAATKQELLKRIGNTSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ITQ, chain A
Confidence level:confident
Coverage over the Query: 31-56,67-161,176-215
View the alignment between query and template
View the model in PyMOL
Template: 2JIG, chain A
Confidence level:confident
Coverage over the Query: 31-217
View the alignment between query and template
View the model in PyMOL
Template: 3KT7, chain A
Confidence level:probable
Coverage over the Query: 6-214
View the alignment between query and template
View the model in PyMOL