Citrus Sinensis ID: 024952


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MPQGDYIELHRKRNGYRLDHFERKRKKEAREVHKRSEIAQKALGIKGKMFAKKRYAEKALMKKTLAMHEESSSRRKVDDEVQEGAVPAYLLDRENTTRAKVLSNTIKQKRKEKAGKWEVPLPKVRPVAEDEMFKVIRSGKRRTKQWKRMVTKATFVGPGFTRKPPKYERFIRPSGLRFTKAHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGKYAQVTNNPENDGCINAVLLV
cccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccccHHcccEEcEEEccccccccccccccccccccccccEEECccccccEEEEEEEEEEECcccccccccccccECcEEEEEEcccccccccccEEEEEEEEEEccccccccCEEEEEcc
**QGDYIELHRKRNGYRLDHFER*******************LGIKGKMFAKKRYAEKA*****************************YLLDRENTTRAKVL****************************EMFKVIRS********KRMVTKATFVGPGFTRKPPKYERFIRPSGLRFTKAHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGKYAQVTNNPENDGCINAVLLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQGDYIELHRKRNGYRLDHFERKRKKEAREVHKRSEIAQKALGIKGKMFAKKRYAEKALMKKTLAMHEESSSRRKVDDEVQEGAVPAYLLDRENTTRAKVLSNTIKQKRKEKAGKWEVPLPKVRPVAEDEMFKVIRSGKRRTKQWKRMVTKATFVGPGFTRKPPKYERFIRPSGLRFTKAHVTHPELKCTFNLEIIGVKKNPNGPMYTSLGVITKGTIIEVNVSELGLVTPAGKVVWGKYAQVTNNPENDGCINAVLLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosome biogenesis protein NSA2 homolog Involved in the biogenesis of the 60S ribosomal subunit. May play a part in the quality control of pre-60S particles.confidentQ9CR47
Ribosome biogenesis protein NSA2 homolog Involved in the biogenesis of the 60S ribosomal subunit. May play a part in the quality control of pre-60S particles.confidentO95478
Ribosome biogenesis protein NSA2 homolog Involved in the biogenesis of the 60S ribosomal subunit. May play a part in the quality control of pre-60S particles.confidentQ54GN8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KCO, chain A
Confidence level:confident
Coverage over the Query: 167-228,241-260
View the alignment between query and template
View the model in PyMOL