Citrus Sinensis ID: 024976

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MESPFKGDILKGKVALLTGGGSGIGFEISLQLGKHGAAIAIMGRRKTVLRSAVAALHSLGIPAIGLEGDVRKREDAVRVVESTINHFGKLDILVNAAAGNFLVPAEDLSPNGFRTVIEIDSVGTFIMCHEALKYLKKGGRGQASSSSGGIIINISATLHYTATWYQIHVSAAKAAVDSITRSLALEWGTDYAIRVNGIAPGPIKDTAGVSKLAPEEIRSKATDYMAAYKFGEKWDIAMAALYLASDAAVHRDLIHLLDD
cccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccHHHHccHHHcccHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccEEEEcc
**SPFKGDILKGKVALLTGGGSGIGFEISLQLGKHGAAIAIMGRRKTVLRSAVAALHSLGIPAIGLEGDVRKREDAVRVVESTINHFGKLDILVNAAAGNFLVPAEDLSPNGFRTVIEIDSVGTFIMCHEALKYLKKGGR***SSSSGGIIINISATLHYTATWYQIHVSAAKAAVDSITRSLALEWGTDYAIRVNGIAPGPIKDTAGVSKLAPEEIRSKATDYMAAYKFGEKWDIAMAALYLASDAAVHRDLIHLLDD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESPFKGDILKGKVALLTGGGSGIGFEISLQLGKHGAAIAIMGRRKTVLRSAVAALHSLGIPAIGLEGDVRKREDAVRVVESTINHFGKLDILVNAAAGNFLVPAEDLSPNGFRTVIEIDSVGTFIMCHEALKYLKKGGRGQASSSSGGIIINISATLHYTATWYQIHVSAAKAAVDSITRSLALEWGTDYAIRVNGIAPGPIKDTAGVSKLAPEEIRSKATDYMAAYKFGEKWDIAMAALYLASDAAVHRDLIHLLDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal 2,4-dienoyl-CoA reductase Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA.confidentQ9LTV6
Probable 2,4-dienoyl-CoA reductase Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA.probableO34717
Peroxisomal 2,4-dienoyl-CoA reductase SPS19 Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Dispensable for growth and sporulation on solid acetate and oleate media, but is essential for these processes to occur on petroselineate.probableP32573

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.3.-.-Acting on the CH-CH group of donors.probable
1.3.1.-10-hydroxytaxane O-acetyltransferase.probable
1.3.1.342,4-dienoyl-CoA reductase (NADPH).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 8-217,228-259
View the alignment between query and template
View the model in PyMOL
Template: 3QLJ, chain A
Confidence level:very confident
Coverage over the Query: 7-214,228-259
View the alignment between query and template
View the model in PyMOL