Citrus Sinensis ID: 025029

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26

MAQNQRLTVVPTVTMLGVMKSRLVGATRGHALLKKKSDALTVQFRQILKNIVTTKESMGEVMKDSSFALIEAKYVAGENIKHIVLENVQNASIKVRSRQENIAGVKIPKFEYFTDGETKNDLTGLARGGQQVQQCRAAYVKAIELLVELASLQTSFLTLDEAIKTTNRRVNALENVVKPRLENTITYIKGELDELEREDFFRLKKIQGYKKREIERQLASSKQFVEEQFAEKVSLQKGISIKSAQNLLSAGEKDEDIIF

ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccEEEEEEEEEEEEEEECccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc

******LTVVPTVTMLGVMKSRLVGATRGHALLKKKSDALTVQFRQILKNIVTTKESMGEVMKDSSFALIEAKYVAGENIKHIVLENVQNASIKVRSRQENIAGVKIPKFEYFTDGETKNDLTGLARGGQQVQQCRAAYVKAIELLVELASLQTSFLTLDEAIKTTNRRVNALENVVKPRLENTITYIKGELDELEREDFFRLKKIQGYKK************************************LSAGEKDEDIIF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAQNQRLTVVPTVTMLGVMKSRLVGATRGHALLKKKSDALTVQFRQILKNIVTTKESMGEVMKDSSFALIEAKYVAGENIKHIVLENVQNASIKVRSRQENIAGVKIPKFEYFTDGETKNDLTGLARGGQQVQQCRAAYVKAIELLVELASLQTSFLTLDEAIKTTNRRVNALENVVxxxxxxxxxxxxxxxxxxxxxDFFRLKKIQGYKKREIERQLASSKQFVEEQFAEKVSLQKGISIKSAQNLLSAGEKDEDIIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
V-type proton ATPase subunit D	Subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.	confident	Q9XGM1
V-type proton ATPase subunit D 1	Subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.	probable	Q9V7D2
V-type proton ATPase subunit D	Subunit of the peripheral V1 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.	probable	Q5RCS8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AON, chain A
Confidence level:very confident
Coverage over the Query: 11-197
View the alignment between query and template
View the model in PyMOL