Citrus Sinensis ID: 025031

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MESSSKSNIQRLIVIAQHLRDYKGPPSTYDQMEQKIRETSGKVTSLVGSQESASPTVRYAKTFRPKKAAVLVCLFEGDNGELRVILTKRASRLSTHSGEVSLPGGKAEEGDEDDGETATREAKEEIGLDPSLVDVVTVIEPFLSKYLLRVVPVIGILHNRKAFKPTPNPGEVEEVFDAPLEMFLKDENRRVEEKEWMGEKYLLHYFNYEQKNKKYLIWGITAAILVRAASVVYQKPPAFEEGNPKFKFPKDVNRDTFMS
cccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEccccccccccEEEEEEEEEccccccccccccccccHHEcccHHHHccccccEEEEEEEccEEEEEEEEEEEEccccEEEEcHHHHHHHHHHHHHHcccccccccccccccccccccccccc
**********RLIVIAQHLRDYKGPPSTYDQMEQKIRE*******************RYAKTFRPKKAAVLVCLFEGDNGELRVILTKRASRLSTHSGEVSLPGGKAEEGDEDDGETATREAKEEIGLDPSLVDVVTVIEPFLSKYLLRVVPVIGILHNRKAFKPTPNPGEVEEVFDAPLEMFLKDENRRVEEKEWMGEKYLLHYFNYEQKNKKYLIWGITAAILVRAASVVYQKPPAFEEGNPKFKFPKDV*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESSSKSNIQRLIVIAQHLRDYKGPPSTYDQMEQKIRETSGKVTSLVGSQESASPTVRYAKTFRPKKAAVLVCLFEGDNGELRVILTKRASRLSTHSGEVSLPGGKAEEGDEDDGETATREAKEEIGLDPSLVDVVTVIEPFLSKYLLRVVPVIGILHNRKAFKPTPNPGEVEEVFDAPLEMFLKDENRRVEEKEWMGEKYLLHYFNYEQKNKKYLIWGITAAILVRAASVVYQKPPAFEEGNPKFKFPKDVNRDTFMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nudix hydrolase 15, mitochondrial Coenzyme A diphosphatase which mediates the cleavage of oxidized CoA. Can use malonyl-CoA, hexanoyl-CoA, lauroyl-CoA, myristoyl-CoA and palmitoyl-CoA as substrates, but not isobutyryl-CoA or propionyl-CoA.confidentQ8GYB1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NQZ, chain A
Confidence level:very confident
Coverage over the Query: 65-230
View the alignment between query and template
View the model in PyMOL