Citrus Sinensis ID: 025040

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MSIAGMNFSLMLNSVGFYQISKLSMIPVVCVMEWILHNKHYSKEVKMAVVVVVIGVGVCTITDVKVNAKGFLCACVAVLSTSLQQITIGSLQKKYSIGSFELLSKTAPIQAVSLLVLGPFVDYYLNGKFITTYKMTSGAILFIFLSCALAVFCNVSQYLCIGRFSATSFQVLGHMKTVCVLTLGWLLFDSALTFKNISGMILAVVGMVIYSWAVEAEKQRNAKTSPQSKNSLTEEEIRLLKEGVENTPVKDVELGETKE
ccEEEEEHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHEEEcEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccccccccccc
MSIAGMNFSLMLNSVGFYQISKLSMIPVVCVMEWILHNKHYSKEVKMAVVVVVIGVGVCTITDVKVNAKGFLCACVAVLSTSLQQITIGSLQKKYSIGSFELLSKTAPIQAVSLLVLGPFVDYYLNGKFITTYKMTSGAILFIFLSCALAVFCNVSQYLCIGRFSATSFQVLGHMKTVCVLTLGWLLFDSALTFKNISGMILAVVGMVIYSWAVE********************************************
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIAGMNFSLMLNSVGFYQISKLSMIPVVCVMEWILHNKHYSKEVKMAVVVVVIGVGVCTITDVKVNAKGFLCACVAVLSTSLQQITIGSLQKKYSIGSFELLSKTAPIQAVSLLVLGPFVDYYLNGKFITTYKMTSGAILFIFLSCALAVFCNVSQYLCIGRFSATSFQVLGHMKTVCVLTLGWLLFDSALTFKNISGMILAVVGMVIYSWAVEAEKQRNAKTSPQSKNSLTEEEIRLLKEGVENTPVKDVELGETKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-galactose transporter 2 UDP-galactose transporter that transports UDP-galactose, UDP-glucose and GDP-fucose.probableQ9SRE4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 153-213
View the alignment between query and template
View the model in PyMOL
Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 3-63
View the alignment between query and template
View the model in PyMOL