Citrus Sinensis ID: 025093


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MAVEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVI
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHcccccccccccccccEEEEEEEc
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcHHHHHHHccHHHHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHcccccEEEcHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccHHHHcccHHcEEEEcccccccHHHHHHHHHccccEEEEEccccccEEEEEEEc
maveysccgmgFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLaksgtpkdrkhaaKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGeiipqsvcsryglaigstvaPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLhgneagkggelthDETTIIAGALELTEktasdamtpiAETFAIDINAKLDKELMNLILEkghsrvpvyyeeptnIIGLILVI
MAVEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGneagkggelthDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEkghsrvpvyyeeptniiglilvi
MAVEYSCCGMGfiihivvivflvmfAglmsgltlglmsmslVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVI
**VEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSG****RKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILV*
******CCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDL***************AKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGR*****RAELKTLVNL*************DETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVI
MAVEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVI
****YSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVI
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query258 2.2.26 [Sep-21-2011]
Q9ZQR4 423 DUF21 domain-containing p yes no 0.996 0.607 0.883 1e-131
Q8VZI2 424 DUF21 domain-containing p no no 0.996 0.606 0.856 1e-125
Q8RY60 527 DUF21 domain-containing p no no 0.996 0.487 0.653 2e-96
Q9LTD8 500 DUF21 domain-containing p no no 0.992 0.512 0.640 8e-93
Q67XQ0 494 DUF21 domain-containing p no no 0.949 0.495 0.626 3e-88
Q4V3C7 495 DUF21 domain-containing p no no 0.949 0.494 0.597 3e-85
Q9ZVS8 499 Putative DUF21 domain-con no no 0.926 0.478 0.620 1e-83
Q12296 706 Protein MAM3 OS=Saccharom yes no 0.934 0.341 0.418 5e-47
Q9USJ3 679 Uncharacterized protein C yes no 0.945 0.359 0.377 2e-44
A0JPA0 769 Metal transporter CNNM4 O yes no 0.930 0.312 0.375 1e-42
>sp|Q9ZQR4|Y2452_ARATH DUF21 domain-containing protein At2g14520 OS=Arabidopsis thaliana GN=CBSDUF3 PE=2 SV=2 Back     alignment and function desciption
 Score =  466 bits (1199), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/257 (88%), Positives = 243/257 (94%)

Query: 1   MAVEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAA 60
           MAVEY CCG  F IHI VIV LV+FAGLMSGLTLGLMSMSLVDLEVLAKSGTP+DR HAA
Sbjct: 1   MAVEYECCGTSFFIHIAVIVLLVLFAGLMSGLTLGLMSMSLVDLEVLAKSGTPRDRIHAA 60

Query: 61  KILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVC 120
           KILPVV+NQHLLLCTLLICNAAAMEALPIFLD LV+AWGAILISVTLILLFGEIIPQSVC
Sbjct: 61  KILPVVKNQHLLLCTLLICNAAAMEALPIFLDALVTAWGAILISVTLILLFGEIIPQSVC 120

Query: 121 SRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNE 180
           SR+GLAIG+TVAPFVRVLVWIC PVA+PISKLLD LLGHGRVALFRRAELKTLV+LHGNE
Sbjct: 121 SRHGLAIGATVAPFVRVLVWICLPVAWPISKLLDFLLGHGRVALFRRAELKTLVDLHGNE 180

Query: 181 AGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSR 240
           AGKGGELTHDETTIIAGALEL+EK A DAMTPI++TF IDINAKLD++LMNLIL+KGHSR
Sbjct: 181 AGKGGELTHDETTIIAGALELSEKMAKDAMTPISDTFVIDINAKLDRDLMNLILDKGHSR 240

Query: 241 VPVYYEEPTNIIGLILV 257
           VPVYYE+ TNIIGL+LV
Sbjct: 241 VPVYYEQRTNIIGLVLV 257





Arabidopsis thaliana (taxid: 3702)
>sp|Q8VZI2|Y4370_ARATH DUF21 domain-containing protein At4g33700 OS=Arabidopsis thaliana GN=CBSDUF6 PE=1 SV=1 Back     alignment and function description
>sp|Q8RY60|Y1733_ARATH DUF21 domain-containing protein At1g47330 OS=Arabidopsis thaliana GN=CBSDUF7 PE=1 SV=1 Back     alignment and function description
>sp|Q9LTD8|Y5279_ARATH DUF21 domain-containing protein At5g52790 OS=Arabidopsis thaliana GN=CBSDUF5 PE=2 SV=2 Back     alignment and function description
>sp|Q67XQ0|Y4424_ARATH DUF21 domain-containing protein At4g14240 OS=Arabidopsis thaliana GN=CBSDUF1 PE=2 SV=1 Back     alignment and function description
>sp|Q4V3C7|Y4423_ARATH DUF21 domain-containing protein At4g14230 OS=Arabidopsis thaliana GN=CBSDUF2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVS8|Y1327_ARATH Putative DUF21 domain-containing protein At1g03270 OS=Arabidopsis thaliana GN=CBSDUF4 PE=4 SV=2 Back     alignment and function description
>sp|Q12296|MAM3_YEAST Protein MAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM3 PE=1 SV=1 Back     alignment and function description
>sp|Q9USJ3|YJ23_SCHPO Uncharacterized protein C4B3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.03c PE=1 SV=1 Back     alignment and function description
>sp|A0JPA0|CNNM4_XENTR Metal transporter CNNM4 OS=Xenopus tropicalis GN=cnnm4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
255562092 425 conserved hypothetical protein [Ricinus 0.996 0.604 0.914 1e-133
449438283 425 PREDICTED: DUF21 domain-containing prote 0.996 0.604 0.910 1e-133
224056311 432 predicted protein [Populus trichocarpa] 0.992 0.592 0.890 1e-130
359475517 430 PREDICTED: DUF21 domain-containing prote 0.996 0.597 0.883 1e-129
42569036 423 CBS and transporter associated domain-co 0.996 0.607 0.883 1e-129
357476069 425 Metal transporter CNNM4 [Medicago trunca 0.996 0.604 0.883 1e-129
356524776 425 PREDICTED: DUF21 domain-containing prote 0.996 0.604 0.871 1e-128
224103813 430 predicted protein [Populus trichocarpa] 0.992 0.595 0.871 1e-125
297836072 432 CBS domain-containing protein [Arabidops 0.996 0.594 0.852 1e-125
357446147 429 CBS domain containing protein [Medicago 0.996 0.599 0.859 1e-125
>gi|255562092|ref|XP_002522054.1| conserved hypothetical protein [Ricinus communis] gi|223538653|gb|EEF40254.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  480 bits (1236), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 235/257 (91%), Positives = 247/257 (96%)

Query: 1   MAVEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAA 60
           MAVEY CC   F IHIVVIVFLV+FAGLMSGLTLGLMSMS+VDLEVLA+SGTPKDRKHAA
Sbjct: 1   MAVEYKCCETEFFIHIVVIVFLVLFAGLMSGLTLGLMSMSIVDLEVLAQSGTPKDRKHAA 60

Query: 61  KILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVC 120
           KILPVVRNQHLLLCTLLICNAAAME LPIFLDGLV+AWGAILISVTLILLFGEIIPQSVC
Sbjct: 61  KILPVVRNQHLLLCTLLICNAAAMETLPIFLDGLVTAWGAILISVTLILLFGEIIPQSVC 120

Query: 121 SRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNE 180
           SR+GLAIG+TVAP VR+LVWIC+PVA+PISKLLD LLGHG VALFRRAELKTLVN HGNE
Sbjct: 121 SRHGLAIGATVAPVVRILVWICFPVAYPISKLLDYLLGHGHVALFRRAELKTLVNFHGNE 180

Query: 181 AGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSR 240
           AGKGGELTHDETTIIAGALELTEKTASDAMTPI+ETFAIDINAKLDKELM+LILEKGHSR
Sbjct: 181 AGKGGELTHDETTIIAGALELTEKTASDAMTPISETFAIDINAKLDKELMSLILEKGHSR 240

Query: 241 VPVYYEEPTNIIGLILV 257
           VPVYYE+PTNIIGLILV
Sbjct: 241 VPVYYEQPTNIIGLILV 257




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449438283|ref|XP_004136918.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224056311|ref|XP_002298798.1| predicted protein [Populus trichocarpa] gi|222846056|gb|EEE83603.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359475517|ref|XP_002272975.2| PREDICTED: DUF21 domain-containing protein At2g14520-like [Vitis vinifera] gi|147815300|emb|CAN61244.1| hypothetical protein VITISV_016135 [Vitis vinifera] Back     alignment and taxonomy information
>gi|42569036|ref|NP_179058.3| CBS and transporter associated domain-containing protein [Arabidopsis thaliana] gi|342179473|sp|Q9ZQR4.2|Y2452_ARATH RecName: Full=DUF21 domain-containing protein At2g14520; AltName: Full=CBS domain-containing protein CBSDUF3 gi|330251214|gb|AEC06308.1| CBS and transporter associated domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357476069|ref|XP_003608320.1| Metal transporter CNNM4 [Medicago truncatula] gi|355509375|gb|AES90517.1| Metal transporter CNNM4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356524776|ref|XP_003531004.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Glycine max] Back     alignment and taxonomy information
>gi|224103813|ref|XP_002313203.1| predicted protein [Populus trichocarpa] gi|222849611|gb|EEE87158.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297836072|ref|XP_002885918.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331758|gb|EFH62177.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357446147|ref|XP_003593351.1| CBS domain containing protein [Medicago truncatula] gi|355482399|gb|AES63602.1| CBS domain containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
TAIR|locus:2055155 423 AT2G14520 "AT2G14520" [Arabido 0.996 0.607 0.785 2e-102
TAIR|locus:2134273 424 AT4G33700 "AT4G33700" [Arabido 0.996 0.606 0.758 7.4e-98
TAIR|locus:2203746 527 AT1G47330 "AT1G47330" [Arabido 0.996 0.487 0.583 3.2e-77
TAIR|locus:2149659 500 AT5G52790 "AT5G52790" [Arabido 0.837 0.432 0.652 7.5e-73
TAIR|locus:2129540 494 AT4G14240 "AT4G14240" [Arabido 0.833 0.435 0.629 8.6e-72
TAIR|locus:2129535 495 AT4G14230 "AT4G14230" [Arabido 0.833 0.434 0.597 2.7e-68
TAIR|locus:2014520 499 AT1G03270 "AT1G03270" [Arabido 0.833 0.430 0.606 5.6e-68
ASPGD|ASPL0000049101 716 AN1876 [Emericella nidulans (t 0.837 0.301 0.454 1.2e-44
CGD|CAL0000380 780 orf19.6979 [Candida albicans ( 0.829 0.274 0.452 1.4e-43
UNIPROTKB|Q59YU4 780 CaO19.6979 "Putative uncharact 0.829 0.274 0.452 1.4e-43
TAIR|locus:2055155 AT2G14520 "AT2G14520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1015 (362.4 bits), Expect = 2.0e-102, P = 2.0e-102
 Identities = 202/257 (78%), Positives = 217/257 (84%)

Query:     1 MAVEYSCCGMGXXXXXXXXXXXXXXAXXXXXXXXXXXXXXXVDLEVLAKSGTPKDRKHAA 60
             MAVEY CCG                A               VDLEVLAKSGTP+DR HAA
Sbjct:     1 MAVEYECCGTSFFIHIAVIVLLVLFAGLMSGLTLGLMSMSLVDLEVLAKSGTPRDRIHAA 60

Query:    61 KILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVC 120
             KILPVV+NQHLLLCTLLICNAAAMEALPIFLD LV+AWGAILISVTLILLFGEIIPQSVC
Sbjct:    61 KILPVVKNQHLLLCTLLICNAAAMEALPIFLDALVTAWGAILISVTLILLFGEIIPQSVC 120

Query:   121 SRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNE 180
             SR+GLAIG+TVAPFVRVLVWIC PVA+PISKLLD LLGHGRVALFRRAELKTLV+LHGNE
Sbjct:   121 SRHGLAIGATVAPFVRVLVWICLPVAWPISKLLDFLLGHGRVALFRRAELKTLVDLHGNE 180

Query:   181 AGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSR 240
             AGKGGELTHDETTIIAGALEL+EK A DAMTPI++TF IDINAKLD++LMNLIL+KGHSR
Sbjct:   181 AGKGGELTHDETTIIAGALELSEKMAKDAMTPISDTFVIDINAKLDRDLMNLILDKGHSR 240

Query:   241 VPVYYEEPTNIIGLILV 257
             VPVYYE+ TNIIGL+LV
Sbjct:   241 VPVYYEQRTNIIGLVLV 257




GO:0003674 "molecular_function" evidence=ND
GO:0005886 "plasma membrane" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2134273 AT4G33700 "AT4G33700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203746 AT1G47330 "AT1G47330" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149659 AT5G52790 "AT5G52790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129540 AT4G14240 "AT4G14240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129535 AT4G14230 "AT4G14230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014520 AT1G03270 "AT1G03270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000049101 AN1876 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0000380 orf19.6979 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59YU4 CaO19.6979 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZQR4Y2452_ARATHNo assigned EC number0.88320.99610.6075yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_I4225
hypothetical protein (432 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00012610
hypothetical protein (232 aa)
       0.445

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
COG1253 429 COG1253, TlyC, Hemolysins and related proteins con 6e-38
pfam01595182 pfam01595, DUF21, Domain of unknown function DUF21 3e-31
COG4536 423 COG4536, CorB, Putative Mg2+ and Co2+ transporter 2e-23
TIGR03520 408 TIGR03520, GldE, gliding motility-associated prote 3e-16
COG4535 293 COG4535, CorC, Putative Mg2+ and Co2+ transporter 5e-08
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain 9e-06
PRK11573 413 PRK11573, PRK11573, hypothetical protein; Provisio 1e-04
PRK15094 292 PRK15094, PRK15094, magnesium/cobalt efflux protei 0.001
>gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
 Score =  137 bits (346), Expect = 6e-38
 Identities = 68/260 (26%), Positives = 126/260 (48%), Gaps = 20/260 (7%)

Query: 13  IIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLL 72
           I+ +++I+ L+  +   S     L+S+    LE LA+ G  +    A   L ++   +  
Sbjct: 4   ILTLLLILLLIALSAFFSAAEFALVSLRRSRLEQLAEEGNKR----AKAALKLIERLNRY 59

Query: 73  LCTLLICN-----------AAAMEAL--PIFLDGLVSAWGAILISVTLILLFGEIIPQSV 119
           L T+ +               A+ AL  P+     +SA  +  I   L ++FGE++P+S+
Sbjct: 60  LSTVQLGITLVSLLLGAVGEPALAALLEPLLEALGLSAALSFAIITFLHVVFGELVPKSI 119

Query: 120 CSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHG- 178
             R    +   +AP +R    + YP+ + ++++ + +L    V       L +       
Sbjct: 120 AIRNPEKVALLIAPPLRFFYRLLYPLIWLLNRIANAILRLFGVEPVEEEALTSTEEELEL 179

Query: 179 -NEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKG 237
            +E+ + G L  +E  +I   L+L ++T  + MTP  +  A+D+   ++ EL+ LILE G
Sbjct: 180 VSESAEEGVLEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESG 238

Query: 238 HSRVPVYYEEPTNIIGLILV 257
           HSR+PVY  +  NIIG++ V
Sbjct: 239 HSRIPVYDGDLDNIIGIVHV 258


Length = 429

>gnl|CDD|216595 pfam01595, DUF21, Domain of unknown function DUF21 Back     alignment and domain information
>gnl|CDD|226911 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE Back     alignment and domain information
>gnl|CDD|226910 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|236933 PRK11573, PRK11573, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 258
PRK11573 413 hypothetical protein; Provisional 100.0
TIGR03520 408 GldE gliding motility-associated protein GldE. Mem 100.0
COG4536 423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 100.0
COG1253 429 TlyC Hemolysins and related proteins containing CB 100.0
PF01595183 DUF21: Domain of unknown function DUF21; InterPro: 99.97
KOG2118 498 consensus Predicted membrane protein, contains two 99.95
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 99.82
COG4535 293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.77
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.59
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 98.48
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.38
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.82
COG4109 432 Predicted transcriptional regulator containing CBS 97.8
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 97.37
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 97.26
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 97.22
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.18
COG3448382 CBS-domain-containing membrane protein [Signal tra 97.17
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 97.17
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 97.15
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 97.04
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 97.02
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 96.97
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 96.89
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 96.83
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 96.81
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 96.81
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 96.81
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 96.78
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 96.77
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 96.75
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 96.74
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 96.7
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 96.67
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 96.66
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 96.66
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 96.65
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 96.64
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 96.64
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 96.61
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 96.58
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 96.55
PLN02274 505 inosine-5'-monophosphate dehydrogenase 96.55
COG0517117 FOG: CBS domain [General function prediction only] 96.54
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 96.54
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 96.54
smart0011649 CBS Domain in cystathionine beta-synthase and othe 96.52
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 96.51
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 96.48
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 96.47
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 96.45
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 96.4
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 96.4
COG3620187 Predicted transcriptional regulator with C-termina 96.4
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 96.38
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 96.36
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 96.36
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 96.36
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 96.34
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.29
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 96.28
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 96.27
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 96.22
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 96.21
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 96.19
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 96.17
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 96.12
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 96.12
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 96.05
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 96.05
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 96.04
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 96.01
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 96.01
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 95.94
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 95.91
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 95.89
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 95.88
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 95.82
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 95.78
PRK14869 546 putative manganese-dependent inorganic pyrophospha 95.74
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 95.73
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 95.73
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 95.73
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 95.72
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 95.71
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 95.7
COG2524294 Predicted transcriptional regulator, contains C-te 95.7
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 95.66
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 95.65
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 95.65
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 95.65
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 95.64
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 95.64
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 95.64
PRK01862574 putative voltage-gated ClC-type chloride channel C 95.59
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 95.57
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 95.56
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 95.55
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 95.54
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 95.52
PRK01862574 putative voltage-gated ClC-type chloride channel C 95.51
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 95.4
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 95.39
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 95.37
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 95.37
cd02205113 CBS_pair The CBS domain, named after human CBS, is 95.35
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 95.35
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 95.34
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 95.3
PRK14869 546 putative manganese-dependent inorganic pyrophospha 95.3
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 95.3
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 95.29
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 95.25
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 95.24
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 95.2
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 95.13
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 95.12
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 95.09
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 95.09
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 95.07
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 95.07
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 95.06
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 95.05
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 95.02
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 94.96
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 94.95
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 94.88
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 94.86
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 94.83
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 94.75
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 94.75
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 94.74
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 94.71
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 94.68
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 94.66
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 94.55
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 94.55
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 94.53
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 94.35
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 94.32
cd02205113 CBS_pair The CBS domain, named after human CBS, is 94.17
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 94.14
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 94.02
COG2905 610 Predicted signal-transduction protein containing c 94.0
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 93.98
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 93.81
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 93.79
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 93.72
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 93.68
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 93.68
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 93.68
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 93.24
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 93.2
COG3448382 CBS-domain-containing membrane protein [Signal tra 93.12
PLN02274 505 inosine-5'-monophosphate dehydrogenase 93.1
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 92.8
COG2524294 Predicted transcriptional regulator, contains C-te 92.76
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 92.74
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 92.71
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 92.69
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 91.98
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 91.6
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 91.57
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 91.09
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 90.52
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 90.41
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 89.75
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 89.32
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 88.98
COG0517117 FOG: CBS domain [General function prediction only] 88.55
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 88.27
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 88.13
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 88.05
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 85.58
KOG0474 762 consensus Cl- channel CLC-7 and related proteins ( 85.12
TIGR03520 408 GldE gliding motility-associated protein GldE. Mem 83.25
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 82.69
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 81.62
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.7e-53  Score=395.35  Aligned_cols=224  Identities=21%  Similarity=0.364  Sum_probs=197.7

Q ss_pred             HHHHHHHHHHHHHHHhcCHHHHHHHHHcCChhhHHhHHHHHHHHHchhHHHHHHHHHHHHHHHHHHHHHh----HHH---
Q 025093           23 VMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLD----GLV---   95 (258)
Q Consensus        23 lllsa~fs~~E~Al~s~~~~rl~~l~~~g~~~~~~~a~~~~~l~~~~~~~l~t~lig~~~~~~~~~~~~~----~~~---   95 (258)
                      +++||||||+|+|++|+++.|+++++++|+++    |++++++++||+++++|+++||+++|...+.+..    ..+   
T Consensus         2 i~lsafFs~~E~Al~s~~~~~l~~l~~~g~~~----a~~l~~l~~~~~~~Lstiligntl~~i~~~~l~~~~~~~~~~~~   77 (413)
T PRK11573          2 VVISAYFSGSETGMMTLNRYRLRHMAKQGNRS----AKRVEKLLRKPDRLISLVLIGNNLVNILASALGTIVGMRLYGDA   77 (413)
T ss_pred             eehhhHHHHHHHHHHHcCHHHHHHHHHcCChh----HHHHHHHHhChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Confidence            57899999999999999999999999999865    6678899999999999999999999876554322    122   


Q ss_pred             HHHHHHHHHHHHHHHHHHHhHHHHHHhhhhHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHH---hcCCC----cccccHH
Q 025093           96 SAWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVL---LGHGR----VALFRRA  168 (258)
Q Consensus        96 ~~~~a~~i~~~l~lvfgEi~PK~la~~~~~~~a~~~a~~l~~~~~l~~P~~~~l~~~~~~l---~~~~~----~~~~s~e  168 (258)
                      +.+.++++.|+++++|||++||++|.+||+++++++++|+++++++++|++|+++++++.+   +|.+.    ...+|+|
T Consensus        78 ~~~ia~~i~t~l~lvfGEiiPK~la~~~~~~~a~~~a~~l~~~~~l~~P~v~~l~~~~~~l~~l~g~~~~~~~~~~~s~e  157 (413)
T PRK11573         78 GVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPLQILMMPLVWLLNTITRLLMRLMGIKTDIVVSGALSKE  157 (413)
T ss_pred             HHHHHHHHHHHHHHhhhhHhHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCccccCCCCCCHH
Confidence            2234566778999999999999999999999999999999999999999999999887754   56532    2468999


Q ss_pred             HHHHHHHhhcccccCCCCCCHhHHHHHHhhhccccccccccccccceEEEEeCCCCccHHHHHHHHHcCCceeeeeeCCC
Q 025093          169 ELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEP  248 (258)
Q Consensus       169 El~~lv~~~~~e~~~~g~l~~~E~~mi~~i~~~~~~~v~eiM~PR~~v~~l~~~~~~~~e~~~~~~~~~~SR~PVy~~~~  248 (258)
                      ||+.+++.+    .  +.++++|++|++|+|+|+|++|+||||||+||++++.+++++ ++++.+.++||||||||+++.
T Consensus       158 El~~lv~~~----~--~~l~~~e~~mi~~vl~l~~~~v~eiMtPr~~i~~l~~~~~~~-e~~~~~~~~~~SR~PVy~~~~  230 (413)
T PRK11573        158 ELRTIVHES----R--SQISRRNQDMLLSVLDLEKVTVDDIMVPRNEIVGIDINDDWK-SILRQLTHSPHGRIVLYRDSL  230 (413)
T ss_pred             HHHHHHHHH----h--hhcCHHHHHHHHHHhccCCCChhhcCCccceEEEEECCCCHH-HHHHHHHhCCCceEEEEcCCC
Confidence            999999842    2  259999999999999999999999999999999999999997 999999999999999999999


Q ss_pred             CcEEEEEEe
Q 025093          249 TNIIGLILV  257 (258)
Q Consensus       249 D~IvGiv~~  257 (258)
                      |||+|++|+
T Consensus       231 D~IiGiv~~  239 (413)
T PRK11573        231 DDAISMLRV  239 (413)
T ss_pred             CceEEEEEH
Confidence            999999995



>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>PF01595 DUF21: Domain of unknown function DUF21; InterPro: IPR002550 This transmembrane region has no known function Back     alignment and domain information
>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
3jtf_A129 The Cbs Domain Pair Structure Of A Magnesium And Co 4e-04
>pdb|3JTF|A Chain A, The Cbs Domain Pair Structure Of A Magnesium And Cobalt Efflux Protein From Bordetella Parapertussis In Complex With Amp Length = 129 Back     alignment and structure

Iteration: 1

Score = 42.0 bits (97), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 203 EKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLIL 256 E+T +D P + +DI+ L +L+ I+E HSR PVY ++ NIIG++L Sbjct: 4 ERTVADIXVPRSRXDLLDISQPL-PQLLATIIETAHSRFPVYEDDRDNIIGILL 56

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 5e-20
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 2e-19
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 1e-17
3ocm_A173 Putative membrane protein; structural genomics, PS 3e-17
3oco_A153 Hemolysin-like protein containing CBS domains; str 5e-16
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 9e-13
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 1e-12
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 2e-12
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 3e-12
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 8e-12
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Length = 156 Back     alignment and structure
 Score = 82.9 bits (206), Expect = 5e-20
 Identities = 15/91 (16%), Positives = 37/91 (40%), Gaps = 5/91 (5%)

Query: 167 RAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLD 226
             ++  L+     +A +      D    +   L+ ++    DAM   +    +  N  ++
Sbjct: 5   AEDVLNLLR----QAHEQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIE 60

Query: 227 KELMNLILEKGHSRVPVYYEEPTNIIGLILV 257
             +   +++  HSR PV  E+   ++G++  
Sbjct: 61  -RITAYVIDTAHSRFPVIGEDKDEVLGILHA 90


>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Length = 172 Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Length = 148 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Length = 173 Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Length = 153 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Length = 129 Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Length = 130 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Length = 130 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Length = 136 Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Length = 127 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.67
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.59
3ocm_A173 Putative membrane protein; structural genomics, PS 99.47
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.41
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.22
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.17
3t4n_C 323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.15
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.06
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 98.98
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 98.86
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 98.86
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 98.83
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 98.81
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 98.75
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 98.68
3kxr_A205 Magnesium transporter, putative; cystathionine bet 98.68
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 98.6
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 98.44
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 98.37
4esy_A 170 CBS domain containing membrane protein; structural 98.29
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 98.29
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 98.26
3lqn_A150 CBS domain protein; csgid, structural genomics, un 98.23
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 98.22
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 98.18
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 98.18
2oux_A286 Magnesium transporter; 10001B, structural genomics 98.18
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.14
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 98.09
3org_A 632 CMCLC; transporter, transport protein; 3.50A {Cyan 98.06
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 98.02
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 98.01
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 97.99
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 97.97
3ddj_A 296 CBS domain-containing protein; structural genomics 97.97
2j9l_A 185 Chloride channel protein 5; ION channel, ION trans 97.97
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 97.92
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 97.91
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 97.9
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 97.87
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 97.86
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.78
1pbj_A125 Hypothetical protein; structural genomics, domain, 97.76
4fry_A157 Putative signal-transduction protein with CBS DOM; 97.76
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 97.75
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 97.74
1vr9_A213 CBS domain protein/ACT domain protein; structural 97.72
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 97.71
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 97.71
4fry_A157 Putative signal-transduction protein with CBS DOM; 97.7
1o50_A157 CBS domain-containing predicted protein TM0935; CB 97.7
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 97.7
2d4z_A 250 Chloride channel protein; CLC chloride channel cyt 97.66
2o16_A 160 Acetoin utilization protein ACUB, putative; struct 97.63
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 97.6
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 97.6
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 97.59
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 97.58
1pvm_A184 Conserved hypothetical protein TA0289; structural 97.56
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 97.55
1o50_A157 CBS domain-containing predicted protein TM0935; CB 97.55
3fio_A70 A cystathionine beta-synthase domain protein fused 97.54
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 97.53
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 97.53
1pbj_A125 Hypothetical protein; structural genomics, domain, 97.52
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.5
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 97.5
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 97.47
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 97.46
2o16_A160 Acetoin utilization protein ACUB, putative; struct 97.46
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 97.44
4esy_A170 CBS domain containing membrane protein; structural 97.37
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 97.35
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 97.31
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 97.29
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 97.29
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 97.27
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 97.27
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 97.26
3oco_A153 Hemolysin-like protein containing CBS domains; str 97.2
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 97.19
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 97.18
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 97.11
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 97.11
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 97.07
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 97.07
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 97.06
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 97.03
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 97.02
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 97.01
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 97.0
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 97.0
3ddj_A 296 CBS domain-containing protein; structural genomics 96.99
3lqn_A150 CBS domain protein; csgid, structural genomics, un 96.99
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 96.96
3kxr_A205 Magnesium transporter, putative; cystathionine bet 96.77
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 96.73
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 96.64
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 96.53
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 96.5
1vr9_A 213 CBS domain protein/ACT domain protein; structural 96.47
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 96.44
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 96.36
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 96.26
2oux_A286 Magnesium transporter; 10001B, structural genomics 96.22
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 96.16
1pvm_A 184 Conserved hypothetical protein TA0289; structural 96.1
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.06
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 96.05
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 95.94
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 95.94
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 95.88
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 95.87
3ocm_A173 Putative membrane protein; structural genomics, PS 95.83
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 95.79
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 95.32
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 95.06
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 94.92
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 94.78
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 93.8
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 93.39
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 92.07
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 85.26
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
Probab=99.67  E-value=7.5e-17  Score=129.41  Aligned_cols=89  Identities=17%  Similarity=0.312  Sum_probs=82.3

Q ss_pred             cccHHHHHHHHHhhcccccCCCCCCHhHHHHHHhhhccccccccccccccceEEEEeCCCCccHHHHHHHHHcCCceeee
Q 025093          164 LFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPV  243 (258)
Q Consensus       164 ~~s~eEl~~lv~~~~~e~~~~g~l~~~E~~mi~~i~~~~~~~v~eiM~PR~~v~~l~~~~~~~~e~~~~~~~~~~SR~PV  243 (258)
                      .+|+|||+.+++.    ++++|.++++|+++++++++|++.+|+|+|+||.++++++.++++. ++++.+.+++|+++||
T Consensus         2 ~~t~~el~~li~~----~~~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~i~-~a~~~m~~~~~~~~pV   76 (156)
T 3oi8_A            2 NASAEDVLNLLRQ----AHEQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIE-RITAYVIDTAHSRFPV   76 (156)
T ss_dssp             CCCHHHHHHHHHH----HHHTTSSCHHHHHHHHHHHHHTTCBGGGTCEEGGGCCCEETTCCHH-HHHHHHHHHCCSEEEE
T ss_pred             CCCHHHHHHHHHh----HHhcCCcCHHHHHHHHHHhccCCCCHhheeeeHHHeEEECCCCCHH-HHHHHHHHCCCCEEEE
Confidence            3799999999984    4456999999999999999999999999999999999999999997 9999999999999999


Q ss_pred             eeCCCCcEEEEEEe
Q 025093          244 YYEEPTNIIGLILV  257 (258)
Q Consensus       244 y~~~~D~IvGiv~~  257 (258)
                      ++++.|+++|+++.
T Consensus        77 vd~~~~~lvGivt~   90 (156)
T 3oi8_A           77 IGEDKDEVLGILHA   90 (156)
T ss_dssp             ESSSTTCEEEEEEG
T ss_pred             EcCCCCcEEEEEEH
Confidence            98876799999973



>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 258
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 7e-04
d2ooxe1 179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 0.004
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 37.1 bits (85), Expect = 7e-04
 Identities = 6/55 (10%), Positives = 23/55 (41%), Gaps = 1/55 (1%)

Query: 201 LTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLI 255
           +      D +   ++    D + ++ K+    ++  G    P++  +  + +G++
Sbjct: 10  MKSHRCYDLIPTSSKLVVFDTSLQV-KKAFFALVTNGVRAAPLWDSKKQSFVGML 63


>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.94
d2ooxe1 179 Uncharacterized protein C1556.08c {Schizosaccharom 98.94
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 98.57
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 98.06
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 98.03
d2j9la1 169 Chloride channel protein 5, ClC-5 {Human (Homo sap 98.02
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.0
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 98.0
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 97.98
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 97.93
d2yzqa1 156 Uncharacterized protein PH1780 {Pyrococcus horikos 97.83
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 97.74
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 97.73
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 97.72
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 97.7
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 97.69
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 97.61
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 97.6
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 97.57
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 97.53
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 97.53
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 97.52
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 97.52
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 97.51
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 97.47
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 97.41
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 97.4
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 97.36
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 97.35
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 97.3
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 97.29
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 97.29
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 97.22
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 97.11
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 97.1
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 97.05
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 97.05
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 96.9
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 96.65
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 96.46
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 96.38
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 96.34
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 96.32
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 96.26
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 96.25
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 96.17
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 96.16
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 96.13
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 95.76
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 95.59
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 94.86
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 94.75
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein YkuL
species: Bacillus subtilis [TaxId: 1423]
Probab=98.94  E-value=2.1e-10  Score=87.41  Aligned_cols=52  Identities=19%  Similarity=0.314  Sum_probs=49.2

Q ss_pred             cccccccccccceEEEEeCCCCccHHHHHHHHHcCCceeeeeeCCCCcEEEEEE
Q 025093          203 EKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLIL  256 (258)
Q Consensus       203 ~~~v~eiM~PR~~v~~l~~~~~~~~e~~~~~~~~~~SR~PVy~~~~D~IvGiv~  256 (258)
                      |++|+++|+|++++++++.+++++ ++++.+.++|||++||++++ ++++|+++
T Consensus         1 e~tv~~~mip~~~v~~v~~~~tl~-~a~~~m~~~~~s~~pVvd~~-~~~vGiit   52 (132)
T d1yava3           1 EATVGQFMIEADKVAHVQVGNNLE-HALLVLTKTGYTAIPVLDPS-YRLHGLIG   52 (132)
T ss_dssp             TCBHHHHSEEGGGSCCEETTCBHH-HHHHHHHHHCCSEEEEECTT-CBEEEEEE
T ss_pred             CCCHHHccccccceEEEcCCCCHH-HHHHHHHhhCCCceEEeecc-cccccEEE
Confidence            689999999999999999999997 99999999999999999876 89999986



>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure