Citrus Sinensis ID: 025099
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| 224096790 | 233 | predicted protein [Populus trichocarpa] | 0.693 | 0.768 | 0.726 | 4e-71 | |
| 255562621 | 233 | phosphoglycerate mutase, putative [Ricin | 0.658 | 0.729 | 0.723 | 2e-68 | |
| 15229783 | 230 | phosphoglycerate mutase [Arabidopsis tha | 0.662 | 0.743 | 0.707 | 1e-65 | |
| 358248962 | 240 | uncharacterized protein LOC100804369 [Gl | 0.686 | 0.737 | 0.668 | 2e-63 | |
| 388498138 | 234 | unknown [Lotus japonicus] | 0.662 | 0.730 | 0.668 | 6e-63 | |
| 357518599 | 240 | 2,3-bisphosphoglycerate-dependent phosph | 0.728 | 0.783 | 0.611 | 1e-62 | |
| 449460634 | 231 | PREDICTED: probable phosphoglycerate mut | 0.666 | 0.744 | 0.680 | 2e-61 | |
| 297816304 | 242 | phosphoglycerate/bisphosphoglycerate mut | 0.658 | 0.702 | 0.651 | 2e-61 | |
| 356514015 | 338 | PREDICTED: probable phosphoglycerate mut | 0.724 | 0.553 | 0.571 | 2e-57 | |
| 388516787 | 234 | unknown [Lotus japonicus] | 0.736 | 0.811 | 0.556 | 1e-53 |
| >gi|224096790|ref|XP_002310737.1| predicted protein [Populus trichocarpa] gi|222853640|gb|EEE91187.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 273 bits (699), Expect = 4e-71, Method: Compositional matrix adjust.
Identities = 130/179 (72%), Positives = 152/179 (84%)
Query: 70 NGSSASVGPDYCEIIVVRHGETPWNVQGKIQGHLDVELNEVGREQAVSVAERLAKEFKIS 129
N SS +V P EIIVVRHGET WNV G++QGH+DVELNEVGREQA VA+RL++EFK+S
Sbjct: 6 NPSSDTVDPTCAEIIVVRHGETVWNVDGRLQGHIDVELNEVGREQAAVVADRLSREFKVS 65
Query: 130 VIYSSDLKRALETAQTIANRCGGLKVIEDPELRERHLGDLQGLVFREAAKVCPIAYQAFL 189
+YSSDLKRA ETA+ IA CG +VI+DP+LRERHLGDLQGLV +EAAKV +AY+AF
Sbjct: 66 AVYSSDLKRAFETAEKIAATCGIAEVIKDPDLRERHLGDLQGLVLQEAAKVSAVAYRAFK 125
Query: 190 SGKTDQDIPGGGESLDQLYRRCTSALQRIARKHIGERIVVVTHGGVIRTLYQRACPNKK 248
S +T+QDIPGGGESLD+LY RCTS+L+RIA KH GER+VVVTHGGVIR LYQRACPN K
Sbjct: 126 SHRTNQDIPGGGESLDKLYDRCTSSLERIAEKHTGERVVVVTHGGVIRELYQRACPNGK 184
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255562621|ref|XP_002522316.1| phosphoglycerate mutase, putative [Ricinus communis] gi|223538394|gb|EEF40000.1| phosphoglycerate mutase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15229783|ref|NP_190621.1| phosphoglycerate mutase [Arabidopsis thaliana] gi|6561992|emb|CAB62481.1| putative protein [Arabidopsis thaliana] gi|14334856|gb|AAK59606.1| unknown protein [Arabidopsis thaliana] gi|17104695|gb|AAL34236.1| unknown protein [Arabidopsis thaliana] gi|332645154|gb|AEE78675.1| phosphoglycerate mutase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|358248962|ref|NP_001239714.1| uncharacterized protein LOC100804369 [Glycine max] gi|255642892|gb|ACU22670.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388498138|gb|AFK37135.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|357518599|ref|XP_003629588.1| 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [Medicago truncatula] gi|355523610|gb|AET04064.1| 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449460634|ref|XP_004148050.1| PREDICTED: probable phosphoglycerate mutase GpmB-like [Cucumis sativus] gi|449528686|ref|XP_004171334.1| PREDICTED: probable phosphoglycerate mutase GpmB-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297816304|ref|XP_002876035.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Arabidopsis lyrata subsp. lyrata] gi|297321873|gb|EFH52294.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356514015|ref|XP_003525703.1| PREDICTED: probable phosphoglycerate mutase gpmB-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388516787|gb|AFK46455.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| TAIR|locus:2098690 | 230 | AT3G50520 [Arabidopsis thalian | 0.674 | 0.756 | 0.708 | 1.3e-61 | |
| TAIR|locus:2146678 | 238 | AT5G04120 [Arabidopsis thalian | 0.647 | 0.701 | 0.562 | 1e-45 | |
| TIGR_CMR|BA_4144 | 192 | BA_4144 "phosphoglycerate muta | 0.585 | 0.786 | 0.365 | 5.1e-19 | |
| UNIPROTKB|P0A7A2 | 215 | ytjC "predicted phosphoglycera | 0.577 | 0.693 | 0.381 | 3.6e-18 | |
| UNIPROTKB|P64955 | 364 | MT2287 "Uncharacterized protei | 0.682 | 0.483 | 0.355 | 1.2e-17 | |
| TIGR_CMR|DET_1422 | 207 | DET_1422 "phosphoglycerate mut | 0.573 | 0.714 | 0.396 | 2e-17 | |
| TIGR_CMR|DET_0659 | 200 | DET_0659 "alpha-ribazole-5-pho | 0.600 | 0.775 | 0.341 | 4.1e-17 | |
| TIGR_CMR|DET_0693 | 200 | DET_0693 "alpha-ribazole-5-pho | 0.600 | 0.775 | 0.341 | 4.1e-17 | |
| CGD|CAL0005147 | 222 | orf19.6056 [Candida albicans ( | 0.562 | 0.653 | 0.333 | 1.3e-15 | |
| POMBASE|SPAC26F1.06 | 211 | gpm1 "monomeric 2,3-bisphospho | 0.604 | 0.739 | 0.327 | 1.3e-15 |
| TAIR|locus:2098690 AT3G50520 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 630 (226.8 bits), Expect = 1.3e-61, P = 1.3e-61
Identities = 124/175 (70%), Positives = 147/175 (84%)
Query: 79 DYCEIIVVRHGETPWNVQGKIQGHLDVELNEVGREQAVSVAERLAKEFKISVIYSSDLKR 138
DY EI+VVRHGET WN + KIQGHLDVELN+ GR+QA VAERL+KE KIS +YSSDLKR
Sbjct: 12 DYAEIVVVRHGETSWNAERKIQGHLDVELNDAGRQQAQRVAERLSKEQKISHVYSSDLKR 71
Query: 139 ALETAQTIANRCGGLKVIEDPELRERHLGDLQGLVFREAAKVCPIAYQAFLSGKTDQDIP 198
A ETAQ IA +CG L+V+ D +LRERHLGD+QGLV++EA+K+ P AY+AF S +TD DIP
Sbjct: 72 AFETAQIIAAKCGKLEVLTDRDLRERHLGDMQGLVYQEASKIRPEAYKAFSSNRTDVDIP 131
Query: 199 GGGESLDQLYRRCTSALQRIARKHIGERIVVVTHGGVIRTLYQRACPN-KKPEVI 252
GGGESLD+LY RCT+ALQRI KH GERIVVVTHGGVIR+LY+RA P+ +K E I
Sbjct: 132 GGGESLDKLYDRCTTALQRIGDKHKGERIVVVTHGGVIRSLYERARPSARKVEKI 186
|
|
| TAIR|locus:2146678 AT5G04120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4144 BA_4144 "phosphoglycerate mutase family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A7A2 ytjC "predicted phosphoglycerate mutase 2" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P64955 MT2287 "Uncharacterized protein Rv2228c/MT2287" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1422 DET_1422 "phosphoglycerate mutase family protein" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0659 DET_0659 "alpha-ribazole-5-phosphate phosphatase, putative" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_0693 DET_0693 "alpha-ribazole-5-phosphate phosphatase, putative" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0005147 orf19.6056 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC26F1.06 gpm1 "monomeric 2,3-bisphosphoglycerate (BPG)-dependent phosphoglycerate mutase (PGAM), Gpm1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0019008001 | hypothetical protein (233 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| eugene3.00080776 | • | • | 0.915 | ||||||||
| grail3.0154005402 | • | • | 0.915 | ||||||||
| estExt_fgenesh4_pm.C_LG_VIII0335 | • | • | 0.909 | ||||||||
| estExt_fgenesh4_pm.C_LG_XII0191 | • | • | 0.909 | ||||||||
| estExt_fgenesh4_pm.C_LG_X0655 | • | • | 0.908 | ||||||||
| estExt_fgenesh4_pm.C_280132 | • | • | 0.908 | ||||||||
| eugene3.00151093 | • | • | 0.907 | ||||||||
| eugene3.00180991 | • | 0.903 | |||||||||
| gw1.XVIII.1835.1 | • | 0.903 | |||||||||
| estExt_Genewise1_v1.C_LG_VI0762 | • | 0.903 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| pfam00300 | 154 | pfam00300, His_Phos_1, Histidine phosphatase super | 4e-52 | |
| COG0406 | 208 | COG0406, phoE, Broad specificity phosphatase PhoE | 2e-51 | |
| smart00855 | 158 | smart00855, PGAM, Phosphoglycerate mutase family | 9e-44 | |
| TIGR03162 | 177 | TIGR03162, ribazole_cobC, alpha-ribazole phosphata | 1e-40 | |
| PRK07238 | 372 | PRK07238, PRK07238, bifunctional RNase H/acid phos | 2e-38 | |
| cd07067 | 153 | cd07067, HP_PGM_like, Histidine phosphatase domain | 9e-37 | |
| PRK03482 | 215 | PRK03482, PRK03482, phosphoglycerate mutase; Provi | 2e-26 | |
| cd07040 | 153 | cd07040, HP, Histidine phosphatase domain found in | 2e-25 | |
| TIGR03848 | 204 | TIGR03848, MSMEG_4193, probable phosphomutase, MSM | 3e-20 | |
| COG0588 | 230 | COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd | 8e-20 | |
| PRK15004 | 199 | PRK15004, PRK15004, alpha-ribazole phosphatase; Pr | 1e-19 | |
| PRK01295 | 206 | PRK01295, PRK01295, phosphoglyceromutase; Provisio | 2e-18 | |
| PRK13463 | 203 | PRK13463, PRK13463, phosphatase PhoE; Provisional | 5e-18 | |
| TIGR01258 | 245 | TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep | 4e-15 | |
| PRK14119 | 228 | PRK14119, gpmA, phosphoglyceromutase; Provisional | 1e-14 | |
| PTZ00123 | 236 | PTZ00123, PTZ00123, phosphoglycerate mutase like-p | 9e-14 | |
| PRK01112 | 228 | PRK01112, PRK01112, phosphoglyceromutase; Provisio | 1e-13 | |
| PRK13462 | 203 | PRK13462, PRK13462, acid phosphatase; Provisional | 1e-13 | |
| PRK14115 | 247 | PRK14115, gpmA, phosphoglyceromutase; Provisional | 1e-13 | |
| PRK14120 | 249 | PRK14120, gpmA, phosphoglyceromutase; Provisional | 2e-13 | |
| PRK14116 | 228 | PRK14116, gpmA, phosphoglyceromutase; Provisional | 8e-13 | |
| PTZ00122 | 299 | PTZ00122, PTZ00122, phosphoglycerate mutase; Provi | 2e-12 | |
| PRK14118 | 227 | PRK14118, gpmA, phosphoglyceromutase; Provisional | 1e-10 | |
| PRK14117 | 230 | PRK14117, gpmA, phosphoglyceromutase; Provisional | 2e-09 | |
| COG2062 | 163 | COG2062, SixA, Phosphohistidine phosphatase SixA [ | 1e-06 |
| >gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) | Back alignment and domain information |
|---|
Score = 166 bits (422), Expect = 4e-52
Identities = 71/158 (44%), Positives = 95/158 (60%), Gaps = 4/158 (2%)
Query: 82 EIIVVRHGETPWNVQGKIQGHLDVELNEVGREQAVSVAERLAKEFKISVIYSSDLKRALE 141
+ +VRHGET WN ++QG D L E+GREQA ++ +RL K IYSS L RA++
Sbjct: 1 RLYLVRHGETEWN-VERLQGDTDSPLTELGREQARALGKRL-KGIPFDRIYSSPLLRAIQ 58
Query: 142 TAQTIANRCGGLKVIEDPELRERHLGDLQGLVFREAAKVCPIAYQAFLSGKTDQDIPGGG 201
TA+ +A G L +I DP LRER GD +GL F E P +A+L D PGG
Sbjct: 59 TAEILAEALG-LPIIVDPRLRERDFGDWEGLTFDEIKAEFPEELRAWLEDPADFRPPGG- 116
Query: 202 ESLDQLYRRCTSALQRIARKHIGERIVVVTHGGVIRTL 239
ESL +Y R +AL+ + KH G +++V+HGGVIR L
Sbjct: 117 ESLADVYERVEAALEELLAKHPGGNVLIVSHGGVIRAL 154
|
The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members. Length = 154 |
| >gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >gnl|CDD|234131 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|180903 PRK07238, PRK07238, bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|179583 PRK03482, PRK03482, phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|163560 TIGR03848, MSMEG_4193, probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
| >gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184966 PRK15004, PRK15004, alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172065 PRK13463, PRK13463, phosphatase PhoE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240280 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|139587 PRK13462, PRK13462, acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240279 PTZ00122, PTZ00122, phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224973 COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| PRK15004 | 199 | alpha-ribazole phosphatase; Provisional | 100.0 | |
| PRK14116 | 228 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK13463 | 203 | phosphatase PhoE; Provisional | 100.0 | |
| PRK14119 | 228 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK03482 | 215 | phosphoglycerate mutase; Provisional | 100.0 | |
| TIGR03162 | 177 | ribazole_cobC alpha-ribazole phosphatase. Members | 100.0 | |
| PRK14117 | 230 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK01295 | 206 | phosphoglyceromutase; Provisional | 100.0 | |
| PRK01112 | 228 | phosphoglyceromutase; Provisional | 100.0 | |
| PRK14118 | 227 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| COG0406 | 208 | phoE Broad specificity phosphatase PhoE and relate | 100.0 | |
| PRK14120 | 249 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| TIGR03848 | 204 | MSMEG_4193 probable phosphomutase, MSMEG_4193 fami | 100.0 | |
| PRK13462 | 203 | acid phosphatase; Provisional | 100.0 | |
| TIGR01258 | 245 | pgm_1 phosphoglycerate mutase, BPG-dependent, fami | 100.0 | |
| PRK14115 | 247 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 100.0 | |
| PF00300 | 158 | His_Phos_1: Histidine phosphatase superfamily (bra | 100.0 | |
| KOG0235 | 214 | consensus Phosphoglycerate mutase [Carbohydrate tr | 100.0 | |
| smart00855 | 155 | PGAM Phosphoglycerate mutase family. Phosphoglycer | 100.0 | |
| COG0588 | 230 | GpmA Phosphoglycerate mutase 1 [Carbohydrate trans | 100.0 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.98 | |
| PTZ00123 | 236 | phosphoglycerate mutase like-protein; Provisional | 99.97 | |
| cd07067 | 153 | HP_PGM_like Histidine phosphatase domain found in | 99.94 | |
| PTZ00122 | 299 | phosphoglycerate mutase; Provisional | 99.94 | |
| KOG4754 | 248 | consensus Predicted phosphoglycerate mutase [Carbo | 99.9 | |
| cd07040 | 153 | HP Histidine phosphatase domain found in a functio | 99.9 | |
| TIGR00249 | 152 | sixA phosphohistidine phosphatase SixA. | 99.85 | |
| PRK10848 | 159 | phosphohistidine phosphatase; Provisional | 99.83 | |
| KOG0234 | 438 | consensus Fructose-6-phosphate 2-kinase/fructose-2 | 99.82 | |
| PRK06193 | 206 | hypothetical protein; Provisional | 99.82 | |
| KOG3734 | 272 | consensus Predicted phosphoglycerate mutase [Carbo | 99.82 | |
| PRK15416 | 201 | lipopolysaccharide core heptose(II)-phosphate phos | 99.81 | |
| KOG4609 | 284 | consensus Predicted phosphoglycerate mutase [Gener | 99.79 | |
| COG2062 | 163 | SixA Phosphohistidine phosphatase SixA [Signal tra | 99.79 | |
| cd07061 | 242 | HP_HAP_like Histidine phosphatase domain found in | 98.15 | |
| PF00328 | 347 | His_Phos_2: Histidine phosphatase superfamily (bra | 97.25 | |
| KOG3720 | 411 | consensus Lysosomal & prostatic acid phosphatases | 95.67 | |
| PRK10173 | 413 | glucose-1-phosphatase/inositol phosphatase; Provis | 95.56 | |
| PRK10172 | 436 | phosphoanhydride phosphorylase; Provisional | 95.39 | |
| KOG1057 | 1018 | consensus Arp2/3 complex-interacting protein VIP1/ | 91.22 | |
| KOG1382 | 467 | consensus Multiple inositol polyphosphate phosphat | 85.88 |
| >PRK15004 alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.1e-39 Score=270.86 Aligned_cols=174 Identities=25% Similarity=0.302 Sum_probs=159.0
Q ss_pred eEEEEEccCCCCccccCcccCCCCCccCHHhHHHHHHHHHHHhhhCCccEEEECChHHHHHHHHHHHHHcCCcceEECCC
Q 025099 81 CEIIVVRHGETPWNVQGKIQGHLDVELNEVGREQAVSVAERLAKEFKISVIYSSDLKRALETAQTIANRCGGLKVIEDPE 160 (258)
Q Consensus 81 ~~i~liRHge~~~n~~~~~~g~~D~pLT~~G~~QA~~l~~~L~~~~~~~~I~sSPl~Ra~qTA~~i~~~l~~~~v~~~~~ 160 (258)
|+||||||||+.+|..+.++|+.|.|||+.|++||+.+++.| ...+++.|||||+.||+|||+++++..+ .++.++++
T Consensus 1 ~~i~lvRHG~t~~n~~~~~~G~~d~pLt~~G~~Qa~~~~~~l-~~~~~~~i~sSpl~Ra~qTA~~i~~~~~-~~~~~~~~ 78 (199)
T PRK15004 1 MRLWLVRHGETQANVDGLYSGHAPTPLTARGIEQAQNLHTLL-RDVPFDLVLCSELERAQHTARLVLSDRQ-LPVHIIPE 78 (199)
T ss_pred CeEEEEeCCCCccccCCcEeCCCCCCcCHHHHHHHHHHHHHH-hCCCCCEEEECchHHHHHHHHHHHhcCC-CCceeChh
Confidence 579999999999999999999999999999999999999999 4578899999999999999999998877 78999999
Q ss_pred cccccCCCCCCCCHHHHHhhChHHHHHhhcCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHhCCCCeEEEEechHHHHHHH
Q 025099 161 LRERHLGDLQGLVFREAAKVCPIAYQAFLSGKTDQDIPGGGESLDQLYRRCTSALQRIARKHIGERIVVVTHGGVIRTLY 240 (258)
Q Consensus 161 L~E~~~g~~~g~~~~~~~~~~p~~~~~~~~~~~~~~~p~~gEs~~~~~~Rv~~~~~~l~~~~~~~~vlIVsHg~~i~~l~ 240 (258)
|+|+++|.|+|++..++.+.+|+.|..|..++.....| +|||+.++..|+.++++.+.+..++++|||||||++|++++
T Consensus 79 L~E~~~G~~eg~~~~~~~~~~~~~~~~~~~~~~~~~~~-~gEs~~~~~~Rv~~~l~~l~~~~~~~~iliVsHg~~i~~l~ 157 (199)
T PRK15004 79 LNEMFFGDWEMRHHRDLMQEDAENYAAWCNDWQHAIPT-NGEGFQAFSQRVERFIARLSAFQHYQNLLIVSHQGVLSLLI 157 (199)
T ss_pred heeCCCcccCCCCHHHHHHHCHHHHHHHHhChhhcCCC-CCcCHHHHHHHHHHHHHHHHHhCCCCeEEEEcChHHHHHHH
Confidence 99999999999999999999999999887765444444 89999999999999999999877778999999999999999
Q ss_pred HHhcCCC----CCCCCCCCCC
Q 025099 241 QRACPNK----KPEVISTKQD 257 (258)
Q Consensus 241 ~~l~~~~----~~~~l~N~s~ 257 (258)
+++++.+ +.+.+.|||.
T Consensus 158 ~~~~~~~~~~~~~~~~~~~~~ 178 (199)
T PRK15004 158 ARLLGMPAEAMWHFRVEQGCW 178 (199)
T ss_pred HHHhCCCHHHHhccccCCceE
Confidence 9999998 5667888874
|
|
| >PRK14116 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK13463 phosphatase PhoE; Provisional | Back alignment and domain information |
|---|
| >PRK14119 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK03482 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >TIGR03162 ribazole_cobC alpha-ribazole phosphatase | Back alignment and domain information |
|---|
| >PRK14117 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK01295 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK01112 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK14118 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14120 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
| >PRK13462 acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >PRK14115 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >KOG0235 consensus Phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00855 PGAM Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00123 phosphoglycerate mutase like-protein; Provisional | Back alignment and domain information |
|---|
| >cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >PTZ00122 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >KOG4754 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >TIGR00249 sixA phosphohistidine phosphatase SixA | Back alignment and domain information |
|---|
| >PRK10848 phosphohistidine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06193 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3734 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG4609 consensus Predicted phosphoglycerate mutase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >PF00328 His_Phos_2: Histidine phosphatase superfamily (branch 2); InterPro: IPR000560 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >KOG3720 consensus Lysosomal & prostatic acid phosphatases [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10173 glucose-1-phosphatase/inositol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10172 phosphoanhydride phosphorylase; Provisional | Back alignment and domain information |
|---|
| >KOG1057 consensus Arp2/3 complex-interacting protein VIP1/Asp1, involved in regulation of actin cytoskeleton [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1382 consensus Multiple inositol polyphosphate phosphatase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 258 | ||||
| 1ebb_A | 202 | Bacillus Stearothermophilus Yhfr Length = 202 | 7e-22 | ||
| 1h2e_A | 207 | Bacillus Stearothermophilus Phoe (Previously Known | 8e-22 | ||
| 1fzt_A | 211 | Solution Structure And Dynamics Of An Open B-Sheet, | 3e-14 | ||
| 1xq9_A | 258 | Structure Of Phosphoglycerate Mutase From Plasmodiu | 5e-14 | ||
| 3kkk_A | 258 | Y92c Catalytic Residue Mutant Of Phosphoglycerate M | 7e-14 | ||
| 3d8h_A | 267 | Crystal Structure Of Phosphoglycerate Mutase From C | 9e-13 | ||
| 2p9z_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 4e-12 | ||
| 2owd_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 5e-12 | ||
| 2owe_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 5e-12 | ||
| 2p6o_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 6e-12 | ||
| 2p9y_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 6e-12 | ||
| 1v37_A | 177 | Crystal Structure Of Phosphoglycerate Mutase From T | 6e-12 | ||
| 2p30_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 6e-12 | ||
| 2p79_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-12 | ||
| 2p6m_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-12 | ||
| 2p2y_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-12 | ||
| 2p77_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-12 | ||
| 2enw_A | 177 | Mutant Y92h Structure Of Tthb049 From Thermus Therm | 7e-12 | ||
| 2p75_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-12 | ||
| 2p2z_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 7e-12 | ||
| 2ekb_A | 177 | Structural Study Of Project Id Tthb049 From Thermus | 7e-12 | ||
| 2pa0_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 1e-11 | ||
| 2p9f_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 1e-11 | ||
| 2p78_A | 177 | Crystal Structure Of Tthb049 From Thermus Thermophi | 1e-11 | ||
| 2enu_A | 177 | Mutant L121m Structure Of Tthb049 From Thermus Ther | 1e-11 | ||
| 2ekz_A | 177 | Structural Study Of Project Id Tthb049 From Thermus | 1e-11 | ||
| 2eoa_A | 177 | Structural Study Of Project Id Tthb049 From Thermus | 2e-11 | ||
| 1e59_A | 249 | E.Coli Cofactor-Dependent Phosphoglycerate Mutase C | 2e-11 | ||
| 4eo9_A | 268 | Crystal Structure Of A Phosphoglycerate Mutase Gpm1 | 7e-11 | ||
| 3e9c_A | 265 | Structure Of A Tryptic Core Fragment Of Tigar From | 7e-11 | ||
| 4pgm_A | 246 | Saccharomyces Cerevisiae Phosphoglycerate Mutase Le | 2e-10 | ||
| 3pgm_A | 244 | The Structure Of Yeast Phosphoglycerate Mutase At 0 | 2e-10 | ||
| 1qhf_A | 240 | Yeast Phosphoglycerate Mutase-3pg Complex Structure | 2e-10 | ||
| 1e58_A | 249 | E.Coli Cofactor-Dependent Phosphoglycerate Mutase L | 2e-10 | ||
| 4emb_A | 274 | Crystal Structure Of A Phosphoglycerate Mutase Gpma | 1e-09 | ||
| 3e9e_A | 265 | Structure Of Full-Length H11a Mutant Form Of Tigar | 1e-09 | ||
| 3dcy_A | 275 | Crystal Structure A Tp53-Induced Glycolysis And Apo | 2e-09 | ||
| 3lnt_A | 250 | Crystal Structure Of Phosphoglyceromutase From Burk | 5e-09 | ||
| 3ezn_A | 257 | Crystal Structure Of Phosphoglyceromutase From Burk | 6e-09 | ||
| 1rii_A | 265 | Crystal Structure Of Phosphoglycerate Mutase From M | 9e-09 | ||
| 1yfk_A | 262 | Crystal Structure Of Human B Type Phosphoglycerate | 5e-08 | ||
| 3fdz_B | 257 | Crystal Structure Of Phosphoglyceromutase From Burk | 6e-08 | ||
| 3hjg_A | 213 | Crystal Structure Of Putative Alpha-Ribazole-5'-Pho | 7e-08 | ||
| 1t8p_A | 267 | Crystal Structure Of Human Erythrocyte 2,3- Bisphos | 2e-07 | ||
| 3f3k_A | 265 | The Structure Of Uncharacterized Protein Ykr043c Fr | 3e-07 | ||
| 3lg2_A | 292 | A Ykr043c FRUCTOSE-1,6-Bisphosphate Product Complex | 4e-07 | ||
| 2a6p_A | 208 | Structure Solution To 2.2 Angstrom And Functional C | 7e-07 | ||
| 3bif_A | 468 | 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase | 8e-07 | ||
| 1bif_A | 469 | 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase | 9e-07 | ||
| 3ll4_A | 292 | Structure Of The H13a Mutant Of Ykr043c In Complex | 1e-06 | ||
| 2hhj_A | 267 | Human Bisphosphoglycerate Mutase Complexed With 2,3 | 2e-06 | ||
| 3oi7_A | 292 | Structure Of The Structure Of The H13a Mutant Of Yk | 6e-06 | ||
| 2bif_A | 469 | 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase | 1e-05 | ||
| 1k6m_A | 432 | Crystal Structure Of Human Liver 6-Phosphofructo-2- | 3e-05 | ||
| 3r7a_A | 237 | Crystal Structure Of Phosphoglycerate Mutase From B | 3e-05 | ||
| 1c7z_A | 191 | Regulatory Complex Of Fructose-2,6-Bisphosphatase L | 4e-05 | ||
| 2axn_A | 520 | Crystal Structure Of The Human Inducible Form 6- Ph | 6e-05 | ||
| 1fbt_A | 190 | The Bisphosphatase Domain Of The Bifunctional Rat L | 6e-04 |
| >pdb|1EBB|A Chain A, Bacillus Stearothermophilus Yhfr Length = 202 | Back alignment and structure |
|
| >pdb|1H2E|A Chain A, Bacillus Stearothermophilus Phoe (Previously Known As Yhfr) In Complex With Phosphate Length = 207 | Back alignment and structure |
| >pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 | Back alignment and structure |
| >pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 | Back alignment and structure |
| >pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 | Back alignment and structure |
| >pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 | Back alignment and structure |
| >pdb|2P9Z|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2OWD|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2OWE|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P6O|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P9Y|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|1V37|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P30|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P79|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P6M|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P2Y|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P77|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2ENW|A Chain A, Mutant Y92h Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P75|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P2Z|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2EKB|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (L19m) Length = 177 | Back alignment and structure |
| >pdb|2PA0|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P9F|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2P78|A Chain A, Crystal Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2ENU|A Chain A, Mutant L121m Structure Of Tthb049 From Thermus Thermophilus Hb8 Length = 177 | Back alignment and structure |
| >pdb|2EKZ|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (l52m) Length = 177 | Back alignment and structure |
| >pdb|2EOA|A Chain A, Structural Study Of Project Id Tthb049 From Thermus Thermophilus Hb8 (W85h) Length = 177 | Back alignment and structure |
| >pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 | Back alignment and structure |
| >pdb|4EO9|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpm1 From Mycobacterium Leprae Length = 268 | Back alignment and structure |
| >pdb|3E9C|A Chain A, Structure Of A Tryptic Core Fragment Of Tigar From Danio Rerio Length = 265 | Back alignment and structure |
| >pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 | Back alignment and structure |
| >pdb|3PGM|A Chain A, The Structure Of Yeast Phosphoglycerate Mutase At 0.28 Nm Resolution Length = 244 | Back alignment and structure |
| >pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 | Back alignment and structure |
| >pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 | Back alignment and structure |
| >pdb|4EMB|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpma From Borrelia Burgdorferi B31 Length = 274 | Back alignment and structure |
| >pdb|3E9E|A Chain A, Structure Of Full-Length H11a Mutant Form Of Tigar From Danio Rerio Length = 265 | Back alignment and structure |
| >pdb|3DCY|A Chain A, Crystal Structure A Tp53-Induced Glycolysis And Apoptosis Regulator Protein From Homo Sapiens Length = 275 | Back alignment and structure |
| >pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 | Back alignment and structure |
| >pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 | Back alignment and structure |
| >pdb|1RII|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From M. Tuberculosis Length = 265 | Back alignment and structure |
| >pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 | Back alignment and structure |
| >pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3- Phosphoglyceric Acid Length = 257 | Back alignment and structure |
| >pdb|3HJG|A Chain A, Crystal Structure Of Putative Alpha-Ribazole-5'-Phosphate Phosphatase Cobc From Vibrio Parahaemolyticus Length = 213 | Back alignment and structure |
| >pdb|1T8P|A Chain A, Crystal Structure Of Human Erythrocyte 2,3- Bisphosphoglycerate Mutase Length = 267 | Back alignment and structure |
| >pdb|3F3K|A Chain A, The Structure Of Uncharacterized Protein Ykr043c From Saccharomyces Cerevisiae. Length = 265 | Back alignment and structure |
| >pdb|3LG2|A Chain A, A Ykr043c FRUCTOSE-1,6-Bisphosphate Product Complex Following Ligand Soaking Length = 292 | Back alignment and structure |
| >pdb|2A6P|A Chain A, Structure Solution To 2.2 Angstrom And Functional Characterisation Of The Open Reading Frame Rv3214 From Mycobacterium Tuberculosis Length = 208 | Back alignment and structure |
| >pdb|3BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Empty 6-Pf-2k Active Site Length = 468 | Back alignment and structure |
| >pdb|1BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Bifunctional Enzyme Complexed With Atp-G-S And Phosphate Length = 469 | Back alignment and structure |
| >pdb|3LL4|A Chain A, Structure Of The H13a Mutant Of Ykr043c In Complex With Fructose-1,6- Bisphosphate Length = 292 | Back alignment and structure |
| >pdb|2HHJ|A Chain A, Human Bisphosphoglycerate Mutase Complexed With 2,3- Bisphosphoglycerate (15 Days) Length = 267 | Back alignment and structure |
| >pdb|3OI7|A Chain A, Structure Of The Structure Of The H13a Mutant Of Ykr043c In Complex With Sedoheptulose-1,7-Bisphosphate Length = 292 | Back alignment and structure |
| >pdb|2BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase H256a Mutant With F6p In Phosphatase Active Site Length = 469 | Back alignment and structure |
| >pdb|1K6M|A Chain A, Crystal Structure Of Human Liver 6-Phosphofructo-2-KinaseFRUCTOSE-2, 6-Bisphosphatase Length = 432 | Back alignment and structure |
| >pdb|3R7A|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Bacillus Anthracis Str. Sterne Length = 237 | Back alignment and structure |
| >pdb|1C7Z|A Chain A, Regulatory Complex Of Fructose-2,6-Bisphosphatase Length = 191 | Back alignment and structure |
| >pdb|2AXN|A Chain A, Crystal Structure Of The Human Inducible Form 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 520 | Back alignment and structure |
| >pdb|1FBT|A Chain A, The Bisphosphatase Domain Of The Bifunctional Rat Liver 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 190 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 9e-71 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 4e-59 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 1e-58 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 9e-57 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 1e-56 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 2e-56 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 2e-46 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 2e-44 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 2e-43 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 1e-42 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 8e-37 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 1e-36 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 8e-36 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 8e-34 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 3e-30 | |
| 3mbk_A | 264 | Ubiquitin-associated and SH3 domain-containing PR; | 2e-25 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 6e-23 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 1e-22 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 2e-22 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 3e-22 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 4e-22 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 6e-22 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 7e-22 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 7e-22 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 8e-22 | |
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 1e-21 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 1e-21 | |
| 3f2i_A | 172 | ALR0221 protein; alpha-beta protein, structural ge | 2e-11 | |
| 2rfl_A | 173 | Putative phosphohistidine phosphatase SIXA; alpha- | 3e-09 | |
| 1ujc_A | 161 | Phosphohistidine phosphatase SIXA; alpha-beta fold | 1e-08 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 2e-08 |
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 | Back alignment and structure |
|---|
Score = 215 bits (549), Expect = 9e-71
Identities = 58/162 (35%), Positives = 89/162 (54%), Gaps = 3/162 (1%)
Query: 82 EIIVVRHGETPWNVQGKIQGHLDVELNEVGREQAVSVAERLAKEFKISVIYSSDLKRALE 141
+ + RHGET WNV+ ++QG D L E GR+ A+ + +RL +++ IY+S RALE
Sbjct: 3 TLYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRLEAV-ELAAIYTSTSGRALE 61
Query: 142 TAQTIANRCGGLKVIEDPELRERHLGDLQGLVFREAAKVCPIAYQAFLSGKTDQDIPGGG 201
TA+ + + + +D LRE HLGD +G E ++ PIA+ F P G
Sbjct: 62 TAEIVRGGR-LIPIYQDERLREIHLGDWEGKTHDEIRQMDPIAFDHFWQAP-HLYAPQRG 119
Query: 202 ESLDQLYRRCTSALQRIARKHIGERIVVVTHGGVIRTLYQRA 243
E + +R A+Q I +H GE +++VTHG V++TL
Sbjct: 120 ERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLMAAF 161
|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Length = 214 | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Length = 202 | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 | Back alignment and structure |
|---|
| >3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 | Back alignment and structure |
|---|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 | Back alignment and structure |
|---|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 | Back alignment and structure |
|---|
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 | Back alignment and structure |
|---|
| >3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Length = 172 | Back alignment and structure |
|---|
| >2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Length = 173 | Back alignment and structure |
|---|
| >1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Length = 161 | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 100.0 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 100.0 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 100.0 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 100.0 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 100.0 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 100.0 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 100.0 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 100.0 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 100.0 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 100.0 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 100.0 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 100.0 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 100.0 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 100.0 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 100.0 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 100.0 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 100.0 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 100.0 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 100.0 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.98 | |
| 3mbk_A | 264 | Ubiquitin-associated and SH3 domain-containing PR; | 99.97 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 99.97 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 99.97 | |
| 1ujc_A | 161 | Phosphohistidine phosphatase SIXA; alpha-beta fold | 99.94 | |
| 2rfl_A | 173 | Putative phosphohistidine phosphatase SIXA; alpha- | 99.93 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.88 | |
| 3f2i_A | 172 | ALR0221 protein; alpha-beta protein, structural ge | 99.86 | |
| 4hbz_A | 186 | Putative phosphohistidine phosphatase, SIXA; struc | 99.77 | |
| 1nd6_A | 354 | Prostatic acid phosphatase; PAP, prostate, phospha | 96.88 | |
| 3ntl_A | 398 | Acid glucose-1-phosphate phosphatase; histidine ac | 96.59 | |
| 2wnh_A | 418 | 3-phytase; histidine acid phosphatase, hydrolase; | 96.51 | |
| 1dkq_A | 410 | Phytase; histidine acid phosphatase fold, hydrolas | 96.47 | |
| 3it3_A | 342 | Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A | 96.44 | |
| 1qwo_A | 442 | Phytase; alpha barrel, beta sandwich, orthogonal b | 96.02 | |
| 3k4q_A | 444 | 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hex | 95.64 | |
| 2gfi_A | 458 | Phytase; hydrolase; HET: NAG; 2.29A {Debaryomyces | 94.43 | |
| 1qfx_A | 460 | Protein (PH 2.5 acid phosphatase); phosphomonoeste | 88.18 |
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-39 Score=271.70 Aligned_cols=174 Identities=33% Similarity=0.508 Sum_probs=160.4
Q ss_pred eEEEEEccCCCCccccCcccCCCCCccCHHhHHHHHHHHHHHhhhCCccEEEECChHHHHHHHHHHHHHcCCcceEECCC
Q 025099 81 CEIIVVRHGETPWNVQGKIQGHLDVELNEVGREQAVSVAERLAKEFKISVIYSSDLKRALETAQTIANRCGGLKVIEDPE 160 (258)
Q Consensus 81 ~~i~liRHge~~~n~~~~~~g~~D~pLT~~G~~QA~~l~~~L~~~~~~~~I~sSPl~Ra~qTA~~i~~~l~~~~v~~~~~ 160 (258)
|+||||||||+.+|..+.++|+.|.|||+.|++||+.++++| ...+++.|||||+.||+|||+++++.++ .++.+++.
T Consensus 2 m~l~lvRHGet~~n~~~~~~g~~D~pLt~~G~~qA~~~~~~l-~~~~~~~i~sSpl~Ra~qTA~~i~~~~~-~~~~~~~~ 79 (207)
T 1h2e_A 2 TTLYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRL-EAVELAAIYTSTSGRALETAEIVRGGRL-IPIYQDER 79 (207)
T ss_dssp EEEEEEECCCBHHHHTTBCCTTSCCCBCHHHHHHHHHHHHHT-TTSCCSEEEECSSHHHHHHHHHHHTTCS-CCEEECGG
T ss_pred CEEEEEeCcCCcccccccCCCCCCCCCCHHHHHHHHHHHHHH-cCCCCCEEEECccHHHHHHHHHHHhcCC-CCeEECcc
Confidence 599999999999999999999999999999999999999999 4578999999999999999999999887 78999999
Q ss_pred cccccCCCCCCCCHHHHHhhChHHHHHhhcCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHhCCCCeEEEEechHHHHHHH
Q 025099 161 LRERHLGDLQGLVFREAAKVCPIAYQAFLSGKTDQDIPGGGESLDQLYRRCTSALQRIARKHIGERIVVVTHGGVIRTLY 240 (258)
Q Consensus 161 L~E~~~g~~~g~~~~~~~~~~p~~~~~~~~~~~~~~~p~~gEs~~~~~~Rv~~~~~~l~~~~~~~~vlIVsHg~~i~~l~ 240 (258)
|+|+++|.|+|++.+++.+.+|+.|..|..++.....| ++|++.++..|+.++++++.+.+++++|+|||||++|++++
T Consensus 80 L~E~~~G~~eg~~~~e~~~~~p~~~~~~~~~~~~~~~p-~gEs~~~~~~R~~~~l~~l~~~~~~~~vlvVsHg~~i~~l~ 158 (207)
T 1h2e_A 80 LREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQ-RGERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLM 158 (207)
T ss_dssp GSCCCCGGGTTCBHHHHHHHCHHHHHHHHHCGGGCCCS-SSCCHHHHHHHHHHHHHHHHHHCTTCEEEEEECHHHHHHHH
T ss_pred cccCCceecCCCCHHHHHHHCHHHHHHHhhCccccCCC-CCccHHHHHHHHHHHHHHHHHhCCCCeEEEEcCHHHHHHHH
Confidence 99999999999999999999999999998876666556 89999999999999999999877788999999999999999
Q ss_pred HHhcCCC----CCCC-CCCCCC
Q 025099 241 QRACPNK----KPEV-ISTKQD 257 (258)
Q Consensus 241 ~~l~~~~----~~~~-l~N~s~ 257 (258)
+++++.+ +.+. ++|||.
T Consensus 159 ~~l~~~~~~~~~~~~~~~n~~i 180 (207)
T 1h2e_A 159 AAFKDTPLDHLWSPPYMYGTSV 180 (207)
T ss_dssp HHHTTCCGGGTTCSCCCCTTCE
T ss_pred HHHhCCCHHHhhhccCCCCCEE
Confidence 9999988 3456 889873
|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A | Back alignment and structure |
|---|
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} | Back alignment and structure |
|---|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A | Back alignment and structure |
|---|
| >1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A | Back alignment and structure |
|---|
| >2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} | Back alignment and structure |
|---|
| >1nd6_A Prostatic acid phosphatase; PAP, prostate, phosphate, inhibi hydrolase; HET: NAG MAN 1PE; 2.40A {Homo sapiens} SCOP: c.60.1.2 PDB: 1nd5_A* 2hpa_A* 1cvi_A* 1rpa_A* 1rpt_A* 2l3h_A 2l77_A 2l79_A | Back alignment and structure |
|---|
| >3ntl_A Acid glucose-1-phosphate phosphatase; histidine acid phosphatase, phytate binding site, hydrolase; HET: IHP; 1.88A {Enterobacter cloacae} PDB: 1nt4_A* | Back alignment and structure |
|---|
| >2wnh_A 3-phytase; histidine acid phosphatase, hydrolase; 1.68A {Klebsiella pneumoniae} PDB: 2wni_A 2wu0_A | Back alignment and structure |
|---|
| >1dkq_A Phytase; histidine acid phosphatase fold, hydrolase; HET: IHP; 2.05A {Escherichia coli} SCOP: c.60.1.2 PDB: 1dkp_A* 1dkm_A 1dkn_A 1dko_A 1dkl_A | Back alignment and structure |
|---|
| >3it3_A Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Francisella tularensis subsp} PDB: 4e3w_A 2glc_A 2glb_A 2gla_A 3it0_A* 3it1_A* 3it2_A 2p36_A* | Back alignment and structure |
|---|
| >1qwo_A Phytase; alpha barrel, beta sandwich, orthogonal bundle, glycoprotein phosphohistidine, hydrolase; HET: NEP NAG; 1.50A {Aspergillus fumigatus} SCOP: c.60.1.2 PDB: 1skb_A* 1sk8_A* 1ska_A* 1sk9_A* | Back alignment and structure |
|---|
| >3k4q_A 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis phosphate phosphohydrolase, 37288-11-2, MYO-inositol hexakis sulfate, 62-1; HET: IHS NAG; 2.20A {Aspergillus niger} SCOP: c.60.1.2 PDB: 3k4p_A* 1ihp_A | Back alignment and structure |
|---|
| >2gfi_A Phytase; hydrolase; HET: NAG; 2.29A {Debaryomyces castellii} | Back alignment and structure |
|---|
| >1qfx_A Protein (PH 2.5 acid phosphatase); phosphomonoesterase, hydrolase; HET: NAG BMA MAN; 2.40A {Aspergillus niger} SCOP: c.60.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 258 | ||||
| d1fzta_ | 211 | c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea | 4e-26 | |
| d1e58a_ | 247 | c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia | 5e-26 | |
| d1xq9a_ | 241 | c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium | 5e-23 | |
| d1h2ea_ | 207 | c.60.1.1 (A:) Broad specificity phosphatase PhoE ( | 8e-23 | |
| d2hhja1 | 248 | c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human | 9e-22 | |
| d1qhfa_ | 240 | c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea | 2e-21 | |
| d1riia_ | 243 | c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri | 2e-19 | |
| d1bifa2 | 219 | c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc | 2e-18 | |
| d1v37a_ | 171 | c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat | 5e-17 |
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphoglycerate mutase-like superfamily: Phosphoglycerate mutase-like family: Cofactor-dependent phosphoglycerate mutase domain: Phosphoglycerate mutase species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
Score = 99.3 bits (246), Expect = 4e-26
Identities = 45/166 (27%), Positives = 65/166 (39%), Gaps = 6/166 (3%)
Query: 83 IIVVRHGETPWNVQGKIQGHLDVELNEVGREQAVSVAERLAKEFKISVIYSSDLKRALET 142
+++ RHGE+ WN G D L+E G ++A ERL I + + +
Sbjct: 10 LVLTRHGESEWNKLNLFTGWKDPALSETGIKEAKLGGERLKSRGYKFDIAFTSALQRAQK 69
Query: 143 AQTIANRCGGLK---VIEDPELRERHLGDLQGLVFREAAKVCPIAYQAFLSGKTDQDIPG 199
I G I+ +L ER+ GDLQGL +A K D P
Sbjct: 70 TCQIILEEVGEPNLETIKSEKLNERYYGDLQGLNKDDARKKWGAEQVQIWRRSYDIAPP- 128
Query: 200 GGESLDQLYRRCTSALQRIARKHI--GERIVVVTHGGVIRTLYQRA 243
GESL R + HI GE++++ HG +R L
Sbjct: 129 NGESLKDTAERVLPYYKSTIVPHILKGEKVLIAAHGNSLRALIMDL 174
|
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Length = 207 | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 | Back information, alignment and structure |
|---|
| >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 | Back information, alignment and structure |
|---|
| >d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| d1h2ea_ | 207 | Broad specificity phosphatase PhoE (YhfR) {Bacillu | 100.0 | |
| d1e58a_ | 247 | Phosphoglycerate mutase {Escherichia coli [TaxId: | 100.0 | |
| d1fzta_ | 211 | Phosphoglycerate mutase {Fission yeast (Schizosacc | 100.0 | |
| d1riia_ | 243 | Phosphoglycerate mutase {Mycobacterium tuberculosi | 100.0 | |
| d2hhja1 | 248 | Phosphoglycerate mutase {Human (Homo sapiens) [Tax | 100.0 | |
| d1bifa2 | 219 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 100.0 | |
| d1xq9a_ | 241 | Phosphoglycerate mutase {Plasmodium falciparum [Ta | 100.0 | |
| d1qhfa_ | 240 | Phosphoglycerate mutase {Baker's yeast (Saccharomy | 100.0 | |
| d1v37a_ | 171 | Alpha-ribazole-5'-phosphate phosphatase {Thermus t | 100.0 | |
| d1qwoa_ | 435 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 97.35 | |
| d1nd6a_ | 342 | Prostatic acid phosphatase {Human (Homo sapiens) [ | 97.32 | |
| d1ihpa_ | 438 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 97.26 | |
| d1dkla_ | 409 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 97.14 | |
| d1nt4a_ | 391 | Glucose-1-phosphatase {Escherichia coli [TaxId: 56 | 96.8 | |
| d1qfxa_ | 447 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 96.56 |
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphoglycerate mutase-like superfamily: Phosphoglycerate mutase-like family: Cofactor-dependent phosphoglycerate mutase domain: Broad specificity phosphatase PhoE (YhfR) species: Bacillus stearothermophilus [TaxId: 1422]
Probab=100.00 E-value=3.7e-40 Score=274.22 Aligned_cols=174 Identities=33% Similarity=0.509 Sum_probs=161.2
Q ss_pred eEEEEEccCCCCccccCcccCCCCCccCHHhHHHHHHHHHHHhhhCCccEEEECChHHHHHHHHHHHHHcCCcceEECCC
Q 025099 81 CEIIVVRHGETPWNVQGKIQGHLDVELNEVGREQAVSVAERLAKEFKISVIYSSDLKRALETAQTIANRCGGLKVIEDPE 160 (258)
Q Consensus 81 ~~i~liRHge~~~n~~~~~~g~~D~pLT~~G~~QA~~l~~~L~~~~~~~~I~sSPl~Ra~qTA~~i~~~l~~~~v~~~~~ 160 (258)
++||||||||+.+|..+.++|+.|+|||+.|++||+.++++| ....++.|||||+.||+|||+.+++..+ .++.+++.
T Consensus 2 tti~lvRHGet~~n~~~~~~G~~D~~Lt~~G~~QA~~~~~~l-~~~~~~~i~sSpl~Ra~qTa~~i~~~~~-~~~~~~~~ 79 (207)
T d1h2ea_ 2 TTLYLTRHGETKWNVERRMQGWQDSPLTEKGRQDAMRLGKRL-EAVELAAIYTSTSGRALETAEIVRGGRL-IPIYQDER 79 (207)
T ss_dssp EEEEEEECCCBHHHHTTBCCTTSCCCBCHHHHHHHHHHHHHT-TTSCCSEEEECSSHHHHHHHHHHHTTCS-CCEEECGG
T ss_pred cEEEEEeCCCCCccccCcccCCCCCCCCHHHHHHHHHHHhhh-hccccceeecCccHHHHHHHhhhccccc-cccccccc
Confidence 689999999999999999999999999999999999999999 5678999999999999999999999887 88999999
Q ss_pred cccccCCCCCCCCHHHHHhhChHHHHHhhcCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHhCCCCeEEEEechHHHHHHH
Q 025099 161 LRERHLGDLQGLVFREAAKVCPIAYQAFLSGKTDQDIPGGGESLDQLYRRCTSALQRIARKHIGERIVVVTHGGVIRTLY 240 (258)
Q Consensus 161 L~E~~~g~~~g~~~~~~~~~~p~~~~~~~~~~~~~~~p~~gEs~~~~~~Rv~~~~~~l~~~~~~~~vlIVsHg~~i~~l~ 240 (258)
|+|+++|.++|++.+++.+.+|..+..|..++.....| +|||+.++..|+..+++.+.+.+++++|||||||++|++++
T Consensus 80 L~E~~~g~~~g~~~~e~~~~~~~~~~~~~~~~~~~~~~-~gEs~~~~~~Rv~~~l~~l~~~~~~~~vlvVsHg~~i~~l~ 158 (207)
T d1h2ea_ 80 LREIHLGDWEGKTHDEIRQMDPIAFDHFWQAPHLYAPQ-RGERFCDVQQRALEAVQSIVDRHEGETVLIVTHGVVLKTLM 158 (207)
T ss_dssp GSCCCCGGGTTCBHHHHHHHCHHHHHHHHHCGGGCCCS-SSCCHHHHHHHHHHHHHHHHHHCTTCEEEEEECHHHHHHHH
T ss_pred ccccCCCcccccccccccccccccccccccCCcccccc-CCcccccccccchhHHHhhhhccCCCeEEEEECHHHHHHHH
Confidence 99999999999999999999999999998887776666 89999999999999999999988889999999999999999
Q ss_pred HHhcCCC----CCC-CCCCCCC
Q 025099 241 QRACPNK----KPE-VISTKQD 257 (258)
Q Consensus 241 ~~l~~~~----~~~-~l~N~s~ 257 (258)
+++++.+ +.. .+.|||.
T Consensus 159 ~~l~~~~~~~~~~~~~~~n~si 180 (207)
T d1h2ea_ 159 AAFKDTPLDHLWSPPYMYGTSV 180 (207)
T ss_dssp HHHTTCCGGGTTCSCCCCTTCE
T ss_pred HHHhCCCHHHHhhccCCCCceE
Confidence 9999988 232 4688873
|
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]} | Back information, alignment and structure |
|---|
| >d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qfxa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|