Citrus Sinensis ID: 025100


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MLRVAARRLLSPSSSSSLRPMASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG
cHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccEEEcccccccccEEEEEEccEEEEEEEccHHHHHHHccccccccccccccccccccccEEEEEcccccccccccccccccccEEcccccccccccccEEccccccccccccEEEccccEEEEc
*********************************************************************************************KRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLA*******LRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRVAARRLLSPSSSSSLRPMASSRNIINGAGSSSSSNDDFRSNGFYGSGYLGPQFQLPCRGVPATVAAVKNPTSKIVYDEYNHERYPPGDPSKRAFAYFVLTGGRFVYASLIRLLILKFVLSMSASKDVLAMASLEVDLSSIEPGSTVTVKWRGKPVFIRRRTEEDIKLANSVDLGSLRDPQQDAERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPSYSFLDENKMLIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome b-c1 complex subunit Rieske-2, mitochondrial Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.probableP51132
Cytochrome b-c1 complex subunit Rieske-4, mitochondrial Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.probableP51134
Cytochrome b-c1 complex subunit Rieske-5, mitochondrial Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.probableP51135

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.10.-.-Acting on diphenols and related substances as donors.probable
1.10.2.-With a cytochrome as acceptor.probable
1.10.2.2Ubiquinol--cytochrome-c reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NWF, chain A
Confidence level:very confident
Coverage over the Query: 134-258
View the alignment between query and template
View the model in PyMOL
Template: 1PP9, chain E
Confidence level:very confident
Coverage over the Query: 67-258
View the alignment between query and template
View the model in PyMOL